Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P055-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MAMLPLVLHWFFIEWYSGK PA
0
21-55 (35) SSSALFQHITALFECSMAAIITLLVSDPVGVLYIR PA
4
59-114 (56) VLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVK PA
4
128-184 (57) SIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVR PA
4
188-207 (20) LIVLFSHWLLHAYGIISISR PA
4
211-233 (23) LEQDLPLLALVPTPALFYLFTAK PA
4
240-248 (9) ILSEGANGH PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center