Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P055-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MACLGLYCGK PA
0
16-30 (15) NGSTEIYGECGVCPR PA
3
39-76 (38) YCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGK PA
3
78-112 (35) SSSALFQHITALFECSMAAIITLLVSDPVGVLYIR PA
4
116-171 (56) VLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVK PA
4
185-241 (57) SIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVR PA
4
245-264 (20) LIVLFSHWLLHAYGIISISR PA
4
268-290 (23) LEQDLPLLALVPTPALFYLFTAK PA
4
297-305 (9) ILSEGANGH PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center