Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P055-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-24 (22) GEIQQSLGAWVLLTCLGLYCGK PA
0
30-44 (15) NGSTEIYGECGVCPR PA
3
53-90 (38) YCQPCTESPELYDWLYLGFMAMLPLVLHWFFIEWYSGK PA
3
92-126 (35) SSSALFQHITALFECSMAAIITLLVSDPVGVLYIR PA
4
130-185 (56) VLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVK PA
4
199-255 (57) SIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVR PA
4
259-278 (20) LIVLFSHWLLHAYGIISISR PA
4
282-304 (23) LEQDLPLLALVPTPALFYLFTAK PA
4
311-319 (9) ILSEGANGH PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center