Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P1Z2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MEESPLSR PA
3
13-22 (10) GGVNFLNVAR PA
3
30-52 (23) VECHYTLPPGTMPSASDWIGIFK PA
3
60-101 (42) DYHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFR PA
2
106-119 (14) QGQVCGQSPPFQFR PA
2
120-145 (26) EPRPMDELVTLEEADGGSDILLVVPK PA
2
146-160 (15) ATVLQNQLDESQQER PA
3
168-178 (11) LQLEGQVTELR PA
3
193-203 (11) QEHTELMEQYK PA
3
208-216 (9) SHGEITEER PA
3
222-229 (8) QQGDHVAR PA
3
230-243 (14) ILELEDDIQTISEK PA
3
280-301 (22) EQSEAELQVAQQENHHLNLDLK PA
2
305-316 (12) SWQEEQSAQAQR PA
2
326-334 (9) DTLGQAQQR PA
2
335-342 (8) VAELEPLK PA
2
347-358 (12) GAQELAASSQQK PA
3
359-373 (15) ATLLGEELASAAAAR PA
3
385-393 (9) LEVAEVNGR PA
3
394-402 (9) LAELGLHLK PA
3
413-423 (11) AGLLQSVEAEK PA
3
459-469 (11) DSSLVQLSESK PA
3
494-501 (8) QELLEYMR PA
3
515-548 (34) WNEDATTEDEEAAVGLSCPAALTDSEDESPEDMR PA
3
549-557 (9) LPPYGLCER PA
3
558-568 (11) GDPGSSPAGPR PA
3
569-603 (35) EASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEK PA
2
604-633 (30) SVLMAAVQSGGEEANLLLPELGSAFYDMAR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center