Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P1Z2-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MEESPLSR PA
3
13-22 (10) GGVNFLNVAR PA
3
30-52 (23) VECHYTLPPGTMPSASDWIGIFK PA
3
60-112 (53) DYHTFVWSSVPESTTDGSPIHTSVQFQEPRPMDELVTLEEADGGSDILLVVPK PA
0
113-127 (15) ATVLQNQLDESQQER PA
3
135-145 (11) LQLEGQVTELR PA
3
160-170 (11) QEHTELMEQYK PA
3
175-183 (9) SHGEITEER PA
3
189-196 (8) QQGDHVAR PA
3
197-210 (14) ILELEDDIQTISEK PA
3
247-257 (11) EQSEAELEPLK PA
0
262-273 (12) GAQELAASSQQK PA
3
274-288 (15) ATLLGEELASAAAAR PA
3
300-308 (9) LEVAEVNGR PA
3
309-317 (9) LAELGLHLK PA
3
328-338 (11) AGLLQSVEAEK PA
3
374-384 (11) DSSLVQLSESK PA
3
409-416 (8) QELLEYMR PA
3
430-463 (34) WNEDATTEDEEAAVGLSCPAALTDSEDESPEDMR PA
3
464-472 (9) LPPYGLCER PA
3
473-483 (11) GDPGSSPAGPR PA
3
484-518 (35) EASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEK PA
2
519-569 (51) SVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWK PA
2
585-606 (22) DALEDHMDGHFFFSTQDPFTFE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center