Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P283-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-27 (27) MPCGFSPSPVAHHLVPGPPDTPAQQLR PA
2
28-41 (14) CGWTVGGWLLSLVR PA
3
42-52 (11) GLLPCLPPGAR PA
3
53-102 (50) TAEGPIMVLAGPLAVSLLLPSLTLLVSHLSSSQDVSSEPSSEQQLCALSK PA
3
103-124 (22) HPTVAFEDLQPWVSNFTYPGAR PA
3
125-143 (19) DFSQLALDPSGNQLIVGAR PA
3
149-169 (21) LSLANVSLLQATEWASSEDTR PA
3
178-187 (10) TEEECQNYVR PA
3
196-211 (16) VFMCGTNAFSPMCTSR PA
3
235-258 (24) HNSTAVISSQGELYAATVIDFSGR PA
3
265-273 (9) SLGSGPPLR PA
3
281-302 (22) WLNEPNFVAAYDIGLFAYFFLR PA
3
303-312 (10) ENAVEHDCGR PA
3
330-341 (12) FLLEDTWTTFMK PA
4
344-404 (61) LNCSRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR PA
3
411-440 (30) AAWLPIANPIPNFQCGTLPETGPNENLTER PA
3
448-470 (23) LFLMSEAVQPVTPEPCVTQDSVR PA
3
471-482 (12) FSHLVVDLVQAK PA
3
483-500 (18) DTLYHVLYIGTESGTILK PA
3
508-524 (17) SLHGCYLEELHVLPPGR PA
3
561-569 (9) SQGACLGAR PA
3
570-578 (9) DPYCGWDGK PA
3
582-604 (23) CSTLEDSSNMSLWTQNITACPVR PA
3
609-635 (27) DGGFGPWSPWQPCEHLDGDNSGSCLCR PA
3
638-645 (8) SCDSPRPR PA
3
646-663 (18) CGGLDCLGPAIHIANCSR PA
3
664-687 (24) NGAWTPWSSWALCSTSCGIGFQVR PA
3
690-697 (8) SCSNPAPR PA
3
712-733 (22) FCNENTPCPVPIFWASWGSWSK PA
3
734-745 (12) CSSNCGGGMQSR PA
3
748-762 (15) ACENGNSCLGCGEFK PA
0
763-773 (11) TCNPEGCPEVR PA
3
775-792 (18) NTPWTPWLPVNVTQGGAR PA
3
803-815 (13) APLADPHGLQFGR PA
3
822-842 (21) TCPADGSGSCDTDALVEVLLR PA
3
843-866 (24) SGSTSPHTVSGGWAAWGPWSSCSR PA
3
878-885 (8) TCTNPEPR PA
3
886-909 (24) NGGLPCVGDAAEYQDCNPQACPVR PA
3
910-932 (23) GAWSCWTSWSPCSASCGGGHYQR PA
3
935-974 (40) SCTSPAPSPGEDICLGLHTEEALCATQACPGWSPWSEWSK PA
0
975-983 (9) CTDDGAQSR PA
3
986-1030 (45) HCEELLPGSSACAGNSSQSRPCPYSEIPVILPASSMEEATDCAGK PA
0
1040-1062 (23) SSQPSSTPLQSLDSFHILLQTAK PA
0
1063-1082 (20) LCWGPHCFEMGSISSTWWPR PA
0
1083-1092 (10) ASPASWALGS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center