Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P283-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MLHLSAEEAIGCVR PA
0
18-27 (10) SFIDELAFGR PA
0
28-35 (8) GHSTGTGK PA
0
42-81 (40) VSGSSWCLACVSWMPCGFSPSPVAHHLVPGPPDTPAQQLR PA
0
82-95 (14) CGWTVGGWLLSLVR PA
3
96-106 (11) GLLPCLPPGAR PA
3
107-156 (50) TAEGPIMVLAGPLAVSLLLPSLTLLVSHLSSSQDVSSEPSSEQQLCALSK PA
3
157-178 (22) HPTVAFEDLQPWVSNFTYPGAR PA
3
179-197 (19) DFSQLALDPSGNQLIVGAR PA
3
203-223 (21) LSLANVSLLQATEWASSEDTR PA
3
232-241 (10) TEEECQNYVR PA
3
250-265 (16) VFMCGTNAFSPMCTSR PA
3
289-312 (24) HNSTAVISSQGELYAATVIDFSGR PA
3
319-327 (9) SLGSGPPLR PA
3
335-356 (22) WLNEPNFVAAYDIGLFAYFFLR PA
3
357-366 (10) ENAVEHDCGR PA
3
384-395 (12) FLLEDTWTTFMK PA
4
398-458 (61) LNCSRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFR PA
3
465-494 (30) AAWLPIANPIPNFQCGTLPETGPNENLTER PA
3
502-524 (23) LFLMSEAVQPVTPEPCVTQDSVR PA
3
525-536 (12) FSHLVVDLVQAK PA
3
537-554 (18) DTLYHVLYIGTESGTILK PA
3
562-578 (17) SLHGCYLEELHVLPPGR PA
3
615-623 (9) SQGACLGAR PA
3
624-632 (9) DPYCGWDGK PA
3
636-658 (23) CSTLEDSSNMSLWTQNITACPVR PA
3
663-689 (27) DGGFGPWSPWQPCEHLDGDNSGSCLCR PA
3
692-699 (8) SCDSPRPR PA
3
700-717 (18) CGGLDCLGPAIHIANCSR PA
3
718-741 (24) NGAWTPWSSWALCSTSCGIGFQVR PA
3
744-751 (8) SCSNPAPR PA
3
766-787 (22) FCNENTPCPVPIFWASWGSWSK PA
3
788-799 (12) CSSNCGGGMQSR PA
3
802-817 (16) ACENGNSCLGCGVEFK PA
2
818-828 (11) TCNPEGCPEVR PA
3
830-847 (18) NTPWTPWLPVNVTQGGAR PA
3
858-870 (13) APLADPHGLQFGR PA
3
877-897 (21) TCPADGSGSCDTDALVEVLLR PA
3
898-921 (24) SGSTSPHTVSGGWAAWGPWSSCSR PA
3
933-940 (8) TCTNPEPR PA
3
941-964 (24) NGGLPCVGDAAEYQDCNPQACPVR PA
3
965-987 (23) GAWSCWTSWSPCSASCGGGHYQR PA
3
990-1030 (41) SCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSK PA
1
1031-1039 (9) CTDDGAQSR PA
3
1042-1118 (77) HCEELLPGSSACAGNSSQSRPCPYSEIPVILPASSMEEATDCAGFNLIHLVATGISCFLGSGLLTLAVYLSCQHCQR PA
2
1119-1137 (19) QSQESTLVHPATPNHLHYK PA
2
1158-1165 (8) NNLIPDDR PA
2
1166-1188 (23) ANFYPLQQTNVYTTTYYPSPLNK PA
2
1189-1200 (12) HSFRPEASPGQR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center