Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2D7-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-32 (19) TPQGPECSSAPAVQVGTHR PA
4
33-40 (8) GLEYNPGK PA
4
41-58 (18) ILPGSDYGLGNPPALDPK PA
4
59-78 (20) LPHLPLPPAPPTLSDLGQPR PA
4
80-87 (8) SPLTGTDK PA
4
96-115 (20) GFYSDILSPGTLDQLGEVCR PA
4
136-148 (13) VGSFEVPEDFQER PA
4
149-159 (11) MEQQCIGSTTR PA
4
160-174 (15) LLAQTDFPLQAYEPK PA
4
175-188 (14) MQVPFQVLPGQHPR PA
4
197-217 (21) QQYLSLDIEQLLFSQGIDSNK PA
4
222-246 (25) HLDHQHPQTIEQGHDPIFPIYLPLK PA
4
247-256 (10) VFDNEDFDCR PA
4
260-273 (14) EWINMGLEPGSLDR PA
4
280-294 (15) ALLPTDDFLGHEDPK PA
4
302-314 (13) WCEVGVLDYDEEK PA
4
330-358 (29) DEMGRPILNAGVTTEGRPPLQVCQYWVPR PA
4
359-374 (16) IQLLFCAEDPCMFAQR PA
4
375-382 (8) VVQANALR PA
4
384-413 (30) NTEALLLYNLYVDCMPSDGQHVISEQSLSK PA
4
416-423 (8) QWALSTPR PA
4
427-439 (13) GPSVLEHLSSLAR PA
4
440-447 (8) EVSLDYER PA
4
452-472 (21) INFDHVVSSKPETFSYVTLPK PA
4
474-481 (8) EEEQVPER PA
4
496-515 (20) EDFTFVSLLTRPEVITALSK PA
4
523-535 (13) VTAMSLFHSSLSK PA
4
536-558 (23) YSHLEEFEQIQSQTFSQVQMFLK PA
4
559-566 (8) DSWISSLK PA
4
579-595 (17) GWYNLYETNWEVYLMSK PA
4
605-612 (8) YMLQDTLR PA
4
613-654 (42) FLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPR PA
4
656-689 (34) NPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDK PA
4
690-702 (13) GILATHAVPQLEK PA
4
703-730 (28) LVMEDIFISGDPLLESVGLHEPLVEELR PA
4
731-739 (9) ATIASAVSK PA
4
740-749 (10) AMIPLQAYAK PA
4
754-767 (14) YLELNNNDIASFLK PA
4
768-780 (13) TYQTQGLLAQEVR PA
4
781-788 (8) EVVLTHLR PA
4
791-814 (24) EILDSSLPSSIIIGPFYINTDNVK PA
4
823-834 (12) ALATSVLDILAK PA
4
839-848 (10) EVDSICEEFR PA
4
854-868 (15) IYEKPNSIEELAELR PA
4
888-910 (23) VMDDYQVMDEFLYNLSSDDFNDK PA
4
911-919 (9) WIASNWPSK PA
4
920-937 (18) ILGQIELVQQQHVEDEEK PA
4
941-952 (12) IQIMDQNNFQEK PA
4
953-971 (19) LEGLQLVVAGFSIHVEISR PA
4
972-980 (9) AHEIANEVR PA
4
988-999 (12) DCQQLAMLYNNR PA
4
1002-1012 (11) IFSLPITNYDK PA
4
1019-1035 (17) EFQPYLDLWTTASDWLR PA
4
1036-1055 (20) WSESWMNDPLSAIDAEQLEK PA
4
1073-1085 (13) DMPACQEVALDIR PA
4
1088-1102 (15) IEEFKPYIPLIQGLR PA
4
1110-1125 (16) HWETLSNQININVRPK PA
4
1133-1147 (15) CLEMNLQDHIESISK PA
4
1155-1164 (10) EYAIEQALDK PA
3
1168-1180 (13) EWSTILFNVLPYK PA
3
1181-1188 (8) ATDTYILK PA
3
1189-1213 (25) SPDEASQLLDDHIVMTQNMSFSPYK PA
3
1229-1242 (14) LTQEVLEEWLNCQR PA
3
1243-1265 (23) SWLYLEPIFSSEDINQQLPVESK PA
3
1286-1295 (10) EVINVCSDLR PA
3
1313-1321 (9) GLSEYLETK PA
3
1328-1344 (17) FYFLSDDELLEILSQTK PA
3
1345-1354 (10) DPTAVQPHLR PA
3
1363-1399 (37) LLFQEDLEITHMYSAEGEEVQLCFSIYPSSNVEDWLR PA
3
1407-1415 (9) ASVHDIIEK PA
3
1426-1459 (34) TQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLR PA
3
1460-1478 (19) SQLFPQLCQQLSDLVALVR PA
3
1487-1500 (14) AVLSALIVIEVHAK PA
3
1506-1524 (19) LIQENVVSVNDFQWISQLR PA
3
1525-1535 (11) YYWTNNDLYIR PA
3
1536-1553 (18) AVNAEFIYGYEYLGNSGR PA
3
1554-1562 (9) LVITPLTDR PA
22
1563-1574 (12) CYLTLTGALHLK PA
3
1575-1587 (13) FGGAPAGPAGTGK PA
3
1597-1618 (22) ALAIQTVVFNCSDQLDFMAMGK PA
3
1622-1637 (16) GLASAGAWACFDEFNR PA
3
1638-1655 (18) IDIEVLSVVAQQITTIQK PA
3
1664-1690 (27) FMFEGVEIPLVPSCAVFITMNPGYAGR PA
3
1691-1698 (8) TELPDNLK PA
5
1699-1732 (34) ALFRPVAMMVPDYAMITEISLYSFGFNEASVLAK PA
3
1740-1756 (17) LSSEQLSSQDHYDFGMR PA
3
1760-1769 (10) TVISAAGNLK PA
3
1771-1783 (13) ENPSMNEELICLR PA
3
1800-1813 (14) LFSGIVSDLFPTIK PA
3
1814-1827 (14) EEDTDYGILDEAIR PA
3
1837-1844 (8) DVEGFLTK PA
3
1845-1855 (11) CIQLYETTVVR PA
3
1856-1868 (13) HGLMLVGPTGSGK PA
3
1874-1883 (10) VLAAAMTSLK PA
3
1884-1904 (21) GQPSISGGMYEAVNYYVLNPK PA
3
1905-1932 (28) SITMGQLYGEFDLLTHEWTDGIFSSFIR PA
3
1933-1942 (10) AGAITSDTNK PA
3
1944-1967 (24) WYMFDGPVDAIWIENMNTVLDDNK PA
3
1969-1978 (10) LCLSSGEIIK PA
3
1979-2002 (24) LTEAMTMMFEVQDLAVASPATVSR PA
3
2003-2024 (22) CGMVYLEPSILGLMPFIECWLR PA
3
2026-2038 (13) LPPLLKPYEEHFK PA
3
2039-2053 (15) ALFVSFLEESISFVR PA
3
2058-2073 (16) EVIASTNCNLTMSLLK PA
3
2074-2085 (12) LLDCFFKPFLPR PA
3
2099-2124 (26) IVELIEPWFIFSLIWSVGATGDSSGR PA
3
2125-2132 (8) TSFSHWLR PA
3
2135-2154 (20) MENEQLTLLFPEEGLVFDYR PA
3
2155-2174 (20) LEDAGISGTNDSEDEEEEYK PA
3
2181-2220 (40) WMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNK PA
3
2221-2233 (13) KPVLCIGPTGTGK PA
3
2244-2259 (16) NLALDYISHFLTFSAR PA
3
2260-2272 (13) TSANQTQDFIDSK PA
3
2279-2287 (9) GVFGPPLGR PA
3
2288-2314 (27) NFIFFIDDLNMPALETYGAQPPIELLR PA
3
2315-2325 (11) QWMDHGGWYDR PA
3
2333-2350 (18) NLVDINFVCAMGPPGGGR PA
3
2360-2374 (15) HFNYLSFAEMDEVSK PA
3
2377-2393 (17) IFSTILGNWLDGLLGEK PA
3
2399-2433 (35) VPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAK PA
3
2434-2441 (8) SHYTFNLR PA
4
2446-2457 (12) VFQGMLMADPAK PA
3
2458-2466 (9) VEDQVQLLR PA
3
2467-2474 (8) LWYHENCR PA
3
2487-2494 (8) SWFDQLLK PA
3
2496-2506 (11) CMEQWEVTFNK PA
3
2507-2526 (20) VCPFQPILYGDFMSPGSDVK PA
3
2527-2536 (10) SYELITSESK PA
3
2537-2555 (19) MMQVIEEYIEDYNQINTAK PA
3
2558-2570 (13) LVLFMDAMSHICR PA
3
2577-2592 (16) QALGNALLLGVGGSGR PA
3
2598-2614 (17) LASHMAEYECFQIELSK PA
3
2615-2622 (8) NYGMSEWR PA
3
2632-2649 (18) AGLQNLPITFLFSDTQIK PA
3
2650-2695 (46) NESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGLQPTK PA
3
2696-2705 (10) ANLMAAYTGR PA
3
2708-2724 (17) SNIHMVLCMSPIGEVFR PA
3
2729-2751 (23) QFPSLVNCCTIDWFNEWPAEALK PA
3
2752-2787 (36) SVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSK PA
3
2789-2798 (10) CIEYLAELTR PA
3
2806-2821 (16) SYLELLHIFSILIGQK PA
3
2849-2865 (17) MQEDLESMHPLLEEAAK PA
3
2866-2875 (10) DTMLTMEQIK PA
3
2876-2885 (10) VDTAIAEETR PA
3
2886-2894 (9) NSVQTEEIK PA
3
2902-2911 (10) AQAIADDAQK PA
3
2912-2928 (17) DLDEALPALDAALASLR PA
3
2940-2949 (10) AMQRPPPGVK PA
3
2950-2959 (10) LVIEAVCIMK PA
3
2966-2974 (9) VPGEKPGTK PA
3
2975-2983 (9) VDDYWEPGK PA
3
2984-2998 (15) GLLQDPGHFLESLFK PA
3
3002-3010 (9) DNIGDVVIK PA
3
3011-3028 (18) AIQPYIDNEEFQPATIAK PA
3
3032-3041 (10) ACTSICQWVR PA
3
3058-3072 (15) QALLEAQDDLGVTQR PA
3
3083-3094 (12) EVEDGIATMQAK PA
3
3122-3130 (9) LINGLSDEK PA
0
3133-3169 (37) WQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYR PA
2
3170-3178 (9) TVLYDSWVK PA
2
3182-3202 (21) SHNVPHTSEPTLIGTLGNPVK PA
2
3205-3229 (25) SWQIAGLPNDTLSVENGVINQFSQR PA
2
3230-3242 (13) WTHFIDPQSQANK PA
2
3250-3257 (8) DNGLDVFK PA
2
3273-3296 (24) FGKPCLLENVGEELDPALEPVLLK PA
2
3301-3308 (8) QQGNTVLK PA
2
3309-3321 (13) LGDTVIPYHEDFR PA
2
3328-3340 (13) LPNPHYTPEISTK PA
2
3341-3373 (33) LTLINFTLSPSGLEDQLLGQVVAEERPDLEEAK PA
2
3374-3382 (9) NQLIISNAK PA
2
3389-3397 (9) DIEDQILYR PA
2
3398-3413 (16) LSSSEGNPVDDMELIK PA
2
3444-3452 (9) MEYIPVAIR PA
2
3453-3490 (38) TQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSER PA
2
3504-3515 (12) YLTYSLYSNVCR PA
2
3523-3532 (10) LMFAFLLCVR PA
2
3547-3569 (23) YLLSGGSISIMTENPAPDWLSDR PA
2
3573-3592 (20) DILALSNLPTFSSFSSDFVK PA
2
3599-3608 (10) VIFDSLEPHR PA
2
3609-3624 (16) EPLPGIWDQYLDQFQK PA
2
3636-3651 (16) VTNAMQDFVATNLEPR PA
2
3652-3665 (14) FIEPQTANLSVVFK PA
2
3666-3689 (24) DSNSTTPLIFVLSPGTDPAADLYK PA
2
3700-3712 (13) LSAISLGQGQGPR PA
2
3726-3744 (19) WVFFQNCHLAPSWMPALER PA
2
3745-3753 (9) LIEHINPDK PA
2
3760-3769 (10) LWLTSLPSNK PA
2
3770-3780 (11) FPVSILQNGSK PA
2
3796-3810 (15) SYSSLGEDFLNSCHK PA
2
3816-3831 (16) SLLLSLCLFHGNALER PA
2
3834-3851 (18) FGPLGFNIPYEFTDGDLR PA
2
3859-3870 (12) MFLDEYDDIPYK PA
2
3874-3884 (11) YTAGEINYGGR PA
2
3893-3936 (44) CIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYDLHGYLSYIK PA
2
3937-3975 (39) SLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPK PA
2
3976-3984 (9) SSSAGSQGR PA
2
3985-3998 (14) EEIVEDVTQNILLK PA
2
3999-4011 (13) VPEPINLQWVMAK PA
2
4012-4030 (19) YPVLYEESMNTVLVQEVIR PA
2
4034-4047 (14) LLQVITQTLQDLLK PA
2
4051-4078 (28) GLVVMSSQLELMAASLYNNTVPELWSAK PA
2
4079-4096 (18) AYPSLKPLSSWVMDLLQR PA
2
4097-4133 (37) LDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFAR PA
2
4135-4147 (13) FVISIDTISFDFK PA
2
4148-4175 (28) VMFEAPSELTQRPQVGCYIHGLFLEGAR PA
1
4176-4189 (14) WDPEAFQLAESQPK PA
1
4190-4206 (17) ELYTEMAVIWLLPTPNR PA
1
4208-4220 (13) AQDQDFYLCPIYK PA
1
4225-4250 (26) AGTLSTTGHSTNYVIAVEIPTHQPQR PA
1
4256-4265 (10) GVALICALDY PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center