Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2D8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-21 (8) YLQEYHNR PA
1
22-40 (19) VLHNIYPVPSGTDIANTLK PA
1
41-52 (12) YFSQTLLSILSR PA
1
57-96 (40) ENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTR PA
1
97-104 (8) SLLYSVLR PA
1
116-191 (76) DAQLSDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMISTLATFPPFLHK PA
1
192-211 (20) DIIEYLSTSFLPMAILGSSR PA
2
213-249 (37) EGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMK PA
2
257-294 (38) DLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYR PA
2
295-321 (27) GLQYTAWNPIHCQHIECHNAINKPAVK PA
2
322-348 (27) MCIDPSLSVALGDKPPPLYLCEECSER PA
2
349-373 (25) IAGDHSEWLIDVLLPQAEISAICQK PA
2
383-395 (13) AVVTCFSAGCCGR PA
2
407-435 (29) CHSNHHSNEVGAAAETHLYQTSPPPINTR PA
2
436-454 (19) ECGAEELVCAVEAVISLLK PA
2
455-463 (9) EAEFHAEQR PA
2
472-490 (19) QLGLSSSHHSLDNADFDNK PA
2
499-525 (27) LLSQFGIWFLVSLCTPSENTPTESLAR PA
2
526-551 (26) LVAMVFQWFHSTAYMMDDEVGSLVEK PA
2
552-559 (8) LKPQFVTK PA
2
569-585 (17) FDVMVMCLLPKPMEFAR PA
2
593-601 (9) SCSTVTQLK PA
2
607-633 (27) ILCLIPYNVINQSVWECIMPEWLEAIR PA
2
634-642 (9) TEVPDNQLK PA
2
651-673 (23) MFDIELCPLPFSMEEMFGFISCR PA
2
674-716 (43) FTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVK PA
2
726-736 (11) VSELAGNLASR PA
2
738-746 (9) VSVASDPGR PA
2
748-765 (18) VQHNMLSPFHSPFQSPFR PA
2
778-785 (8) NFGHPGGR PA
2
786-810 (25) TIDFDCEDDEMNLNCFILMFDLLLK PA
2
811-829 (19) QMELQDDGITMGLEHSLSK PA
2
830-851 (22) DIISIINNVFQAPWGGSHTCQK PA
2
855-877 (23) AIECNLCQSSILCYQLACELLER PA
2
886-919 (34) LVEPTDSLEDSLLSSRPEFIIGPEGEEEENPASK PA
2
920-937 (18) HGENPGNCTEPVEHAAVK PA
2
944-954 (11) FCYQQLPVTLR PA
2
955-965 (11) LIYTIFQEMAK PA
2
966-980 (15) FEEPDILFNMLNCLK PA
2
981-993 (13) ILCLHGECLYIAR PA
2
995-1014 (20) DHPQFLAYIQDHMLIASLWR PA
2
1018-1055 (38) SEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSK PA
2
1073-1081 (9) FLDIHSVTK PA
2
1087-1110 (24) YSLAHAFCCFLTAVEDVNPAVATR PA
2
1111-1119 (9) AGLLLDTIK PA
2
1120-1139 (20) RPALQGLCLCLDFQFDTVVK PA
2
1140-1147 (8) DRPTILSK PA
2
1148-1155 (8) LLLLHFLK PA
2
1156-1169 (14) QDIPALSWEFFVNR PA
2
1170-1185 (16) FETLSLEAQLHLDCNK PA
2
1186-1197 (12) EFPFPTTITAVR PA
2
1198-1210 (13) TNVANLSDAALWK PA
2
1240-1250 (11) ALSLPETLTSK PA
2
1253-1263 (11) QQSPENDNTIK PA
1
1264-1286 (23) DLLPEDAGIDHQTVHQLITVLMK PA
2
1291-1303 (13) DESSAESDISSAK PA
2
1311-1331 (21) HLYVLLGYDQQEGCFMIAPQK PA
2
1334-1357 (24) LSTCFNAFIAGIAQVMDYNINLGK PA
2
1358-1368 (11) HLLPLVVQVLK PA
2
1369-1376 (8) YCSCPQLR PA
2
1377-1384 (8) HYFQQPPR PA
2
1385-1395 (11) CSLWSLKPHIR PA
2
1401-1408 (8) ALLVILYK PA
2
1419-1456 (38) ILLHLIHITVNTLNAQYHSCKPHATAGPLYSDNSNISR PA
2
1463-1471 (9) GEIELAEYR PA
2
1472-1485 (14) ETGALQDSLLHCVR PA
2
1501-1518 (18) SLDIGNADSLLFTLDEHR PA
2
1526-1547 (22) CDIEKPPTQAAYIAQRPNDPGR PA
2
1550-1574 (25) QNSATRPDNSEIPENPAMEGFPDAR PA
2
1575-1582 (8) RPVIPEVR PA
2
1583-1592 (10) LNCMETFEVK PA
2
1593-1602 (10) VDSPVKPAPK PA
2
1603-1620 (18) EDLDLIDLSSDSTSGPEK PA
2
1621-1641 (21) HSILSTSDSDSLVFEPLPPLR PA
2
1642-1662 (21) IVESDEEEETMNQGDDGPSGK PA
2
1663-1694 (32) NAASSPSVPSHPSVLSLSTAPLVQVSVEDCSK PA
2
1700-1744 (45) DSGNNQSAGNTDSALITLEDPMDAEGSSKPEELPEFSCGSPLTLK PA
2
1753-1784 (32) SFALPEMSLDDHPDPGTEGEKPGELMPSSGAK PA
2
1790-1817 (28) VPEDAENPTESEKPDTSAESDTEQNPER PA
2
1819-1830 (12) VEEDGAEESEFK PA
2
1843-1850 (8) IAVSAIQR PA
2
1851-1862 (12) EYLDISFNILDK PA
2
1875-1883 (9) GLSTLEMPR PA
2
1884-1909 (26) ESSSAPTLDAGVPETSSHSSISTQYR PA
2
1914-1926 (13) GSLGVLTMSQLMK PA
2
1928-1951 (24) QLEHQSSAPHNISNWDTEQIQPGK PA
2
1953-1970 (18) QCNVPTCLNPDLEGQPLR PA
2
1977-2007 (31) SSLLSAPSIVSMFVPAPEEFTDEQPTVMTDK PA
2
2008-2054 (47) CHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGR PA
2
2055-2079 (25) LASSTTFSNQAESMMVPGNAAGVAK PA
2
2084-2104 (21) CIFHQLAPNGIFPQLFQSTIK PA
2
2111-2138 (28) TLASSLMDFNELSSIAALSQLLEGLNNK PA
2
2140-2149 (10) NLPAGGAMIR PA
2
2150-2183 (34) CLENIATFMEALPMDSPSSLWTTISNQFQTFFAK PA
2
2184-2191 (8) LPCVLPLK PA
2
2192-2199 (8) CSLDSSLR PA
2
2207-2214 (8) IPSTNATR PA
2
2215-2222 (8) SLLEPFSK PA
2
2223-2247 (25) LLSFVIQNAVFTLAYLVELCGLCYR PA
2
2261-2271 (11) SVVLELLQALK PA
2
2274-2295 (22) SPLPDTNLLLLVQFICADAGTK PA
2
2296-2304 (9) LAESTILSK PA
2
2305-2322 (18) QMIASVPGCGTAAMECVR PA
2
2323-2340 (18) QYINEVLDFMADMHTLTK PA
2
2347-2362 (16) TCSQPLHEDTFGGHLK PA
2
2363-2375 (13) VGLAQIAAMDISR PA
2
2387-2403 (17) YLPWLYHPPSAMQQGPK PA
2
2404-2413 (10) EFIECVSHIR PA
2
2414-2463 (50) LLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPEQSK PA
2
2464-2515 (52) TSVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSR PA
2
2516-2528 (13) VTPSILQLMAHNK PA
2
2529-2555 (27) VMVEMVCLHVISLMEALQECNSTIFVK PA
2
2556-2569 (14) LIPMWLPMIQSNIK PA
2
2570-2578 (9) HLSAGLQLR PA
2
2579-2592 (14) LQAIQNHVNHHSLR PA
2
2593-2608 (16) TLPGSGQSSAGLAALR PA
2
2610-2617 (8) WLQCTQFK PA
2
2618-2635 (18) MAQVEIQSSEAASQFYPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center