Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2D8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MISTLATFPPFLHK PA
0
15-34 (20) DIIEYLSTSFLPMAILGSSR PA
2
36-72 (37) EGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMK PA
2
80-117 (38) DLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYR PA
2
118-144 (27) GLQYTAWNPIHCQHIECHNAINKPAVK PA
2
145-171 (27) MCIDPSLSVALGDKPPPLYLCEECSER PA
2
172-196 (25) IAGDHSEWLIDVLLPQAEISAICQK PA
2
206-218 (13) AVVTCFSAGCCGR PA
2
230-258 (29) CHSNHHSNEVGAAAETHLYQTSPPPINTR PA
2
259-277 (19) ECGAEELVCAVEAVISLLK PA
2
278-286 (9) EAEFHAEQR PA
2
295-313 (19) QLGLSSSHHSLDNADFDNK PA
2
322-348 (27) LLSQFGIWFLVSLCTPSENTPTESLAR PA
2
349-374 (26) LVAMVFQWFHSTAYMMDDEVGSLVEK PA
2
375-382 (8) LKPQFVTK PA
2
392-408 (17) FDVMVMCLLPKPMEFAR PA
2
416-424 (9) SCSTVTQLK PA
2
430-456 (27) ILCLIPYNVINQSVWECIMPEWLEAIR PA
2
457-465 (9) TEVPDNQLK PA
2
474-496 (23) MFDIELCPLPFSMEEMFGFISCR PA
2
497-539 (43) FTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVK PA
2
549-559 (11) VSELAGNLASR PA
2
561-569 (9) VSVASDPGR PA
2
571-588 (18) VQHNMLSPFHSPFQSPFR PA
2
601-608 (8) NFGHPGGR PA
2
609-633 (25) TIDFDCEDDEMNLNCFILMFDLLLK PA
2
634-652 (19) QMELQDDGITMGLEHSLSK PA
2
653-674 (22) DIISIINNVFQAPWGGSHTCQK PA
2
678-700 (23) AIECNLCQSSILCYQLACELLER PA
2
709-742 (34) LVEPTDSLEDSLLSSRPEFIIGPEGEEEENPASK PA
2
743-760 (18) HGENPGNCTEPVEHAAVK PA
2
767-777 (11) FCYQQLPVTLR PA
2
778-788 (11) LIYTIFQEMAK PA
2
789-803 (15) FEEPDILFNMLNCLK PA
2
804-816 (13) ILCLHGECLYIAR PA
2
818-837 (20) DHPQFLAYIQDHMLIASLWR PA
2
841-878 (38) SEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSK PA
2
896-904 (9) FLDIHSVTK PA
2
910-933 (24) YSLAHAFCCFLTAVEDVNPAVATR PA
2
934-942 (9) AGLLLDTIK PA
2
943-962 (20) RPALQGLCLCLDFQFDTVVK PA
2
963-970 (8) DRPTILSK PA
2
971-978 (8) LLLLHFLK PA
2
979-992 (14) QDIPALSWEFFVNR PA
2
993-1008 (16) FETLSLEAQLHLDCNK PA
2
1009-1020 (12) EFPFPTTITAVR PA
2
1021-1033 (13) TNVANLSDAALWK PA
2
1063-1073 (11) ALSLPETLTSK PA
2
1076-1086 (11) QQSPENDNTIK PA
1
1087-1109 (23) DLLPEDAGIDHQTVHQLITVLMK PA
2
1114-1126 (13) DESSAESDISSAK PA
2
1134-1154 (21) HLYVLLGYDQQEGCFMIAPQK PA
2
1157-1180 (24) LSTCFNAFIAGIAQVMDYNINLGK PA
2
1181-1191 (11) HLLPLVVQVLK PA
2
1192-1199 (8) YCSCPQLR PA
2
1200-1207 (8) HYFQQPPR PA
2
1208-1218 (11) CSLWSLKPHIR PA
2
1224-1231 (8) ALLVILYK PA
2
1242-1279 (38) ILLHLIHITVNTLNAQYHSCKPHATAGPLYSDNSNISR PA
2
1286-1294 (9) GEIELAEYR PA
2
1295-1308 (14) ETGALQDSLLHCVR PA
2
1324-1341 (18) SLDIGNADSLLFTLDEHR PA
2
1349-1370 (22) CDIEKPPTQAAYIAQRPNDPGR PA
2
1373-1397 (25) QNSATRPDNSEIPENPAMEGFPDAR PA
2
1398-1405 (8) RPVIPEVR PA
2
1406-1415 (10) LNCMETFEVK PA
2
1416-1425 (10) VDSPVKPAPK PA
2
1426-1443 (18) EDLDLIDLSSDSTSGPEK PA
2
1444-1464 (21) HSILSTSDSDSLVFEPLPPLR PA
2
1465-1485 (21) IVESDEEEETMNQGDDGPSGK PA
2
1486-1517 (32) NAASSPSVPSHPSVLSLSTAPLVQVSVEDCSK PA
2
1523-1567 (45) DSGNNQSAGNTDSALITLEDPMDAEGSSKPEELPEFSCGSPLTLK PA
2
1576-1607 (32) SFALPEMSLDDHPDPGTEGEKPGELMPSSGAK PA
2
1613-1640 (28) VPEDAENPTESEKPDTSAESDTEQNPER PA
2
1642-1653 (12) VEEDGAEESEFK PA
2
1666-1673 (8) IAVSAIQR PA
2
1674-1685 (12) EYLDISFNILDK PA
2
1698-1706 (9) GLSTLEMPR PA
2
1707-1732 (26) ESSSAPTLDAGVPETSSHSSISTQYR PA
2
1737-1749 (13) GSLGVLTMSQLMK PA
2
1751-1774 (24) QLEHQSSAPHNISNWDTEQIQPGK PA
2
1776-1793 (18) QCNVPTCLNPDLEGQPLR PA
2
1800-1830 (31) SSLLSAPSIVSMFVPAPEEFTDEQPTVMTDK PA
2
1831-1877 (47) CHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGR PA
2
1878-1902 (25) LASSTTFSNQAESMMVPGNAAGVAK PA
2
1907-1927 (21) CIFHQLAPNGIFPQLFQSTIK PA
2
1934-1961 (28) TLASSLMDFNELSSIAALSQLLEGLNNK PA
2
1963-1972 (10) NLPAGGAMIR PA
2
1973-2006 (34) CLENIATFMEALPMDSPSSLWTTISNQFQTFFAK PA
2
2007-2014 (8) LPCVLPLK PA
2
2015-2022 (8) CSLDSSLR PA
2
2030-2037 (8) IPSTNATR PA
2
2038-2045 (8) SLLEPFSK PA
2
2046-2070 (25) LLSFVIQNAVFTLAYLVELCGLCYR PA
2
2084-2094 (11) SVVLELLQALK PA
2
2097-2118 (22) SPLPDTNLLLLVQFICADAGTK PA
2
2119-2127 (9) LAESTILSK PA
2
2128-2145 (18) QMIASVPGCGTAAMECVR PA
2
2146-2163 (18) QYINEVLDFMADMHTLTK PA
2
2170-2185 (16) TCSQPLHEDTFGGHLK PA
2
2186-2198 (13) VGLAQIAAMDISR PA
2
2210-2226 (17) YLPWLYHPPSAMQQGPK PA
2
2227-2236 (10) EFIECVSHIR PA
2
2237-2286 (50) LLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPEQSK PA
2
2287-2338 (52) TSVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSR PA
2
2339-2351 (13) VTPSILQLMAHNK PA
2
2352-2378 (27) VMVEMVCLHVISLMEALQECNSTIFVK PA
2
2379-2392 (14) LIPMWLPMIQSNIK PA
2
2393-2401 (9) HLSAGLQLR PA
2
2402-2415 (14) LQAIQNHVNHHSLR PA
2
2416-2431 (16) TLPGSGQSSAGLAALR PA
2
2433-2440 (8) WLQCTQFK PA
2
2441-2458 (18) MAQVEIQSSEAASQFYPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center