Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2D8-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-21 (8) YLQEYHNR PA
1
22-40 (19) VLHNIYPVPSGTDIANTLK PA
1
41-52 (12) YFSQTLLSILSR PA
1
57-96 (40) ENQDASNLTVPMTMCLFPVPFPLTPSLRPQVSSINPTVTR PA
1
97-104 (8) SLLYSVLR PA
1
116-191 (76) DAQLSDYPSLDYQGLYVTLVTLLDLVPLLQHGQHDLGQSIFYTTTCLLPFLNDDILSTLPYTMISTLATFPPFLHK PA
1
192-211 (20) DIIEYLSTSFLPMAILGSSR PA
2
213-249 (37) EGVPAHVNLSASSMLMIAMQYTSNPVYHCQLLECLMK PA
2
257-294 (38) DLLYVIAYGPSQVKPPAVQMLFHYWPNLKPPGAISEYR PA
2
295-321 (27) GLQYTAWNPIHCQHIECHNAINKPAVK PA
2
322-348 (27) MCIDPSLSVALGDKPPPLYLCEECSER PA
2
349-373 (25) IAGDHSEWLIDVLLPQAEISAICQK PA
2
383-395 (13) AVVTCFSAGCCGR PA
2
407-435 (29) CHSNHHSNEVGAAAETHLYQTSPPPINTR PA
2
436-454 (19) ECGAEELVCAVEAVISLLK PA
2
455-463 (9) EAEFHAEQR PA
2
472-490 (19) QLGLSSSHHSLDNADFDNK PA
2
499-525 (27) LLSQFGIWFLVSLCTPSENTPTESLAR PA
2
526-551 (26) LVAMVFQWFHSTAYMMDDEVGSLVEK PA
2
552-559 (8) LKPQFVTK PA
2
569-585 (17) FDVMVMCLLPKPMEFAR PA
2
593-601 (9) SCSTVTQLK PA
2
607-633 (27) ILCLIPYNVINQSVWECIMPEWLEAIR PA
2
634-642 (9) TEVPDNQLK PA
2
651-673 (23) MFDIELCPLPFSMEEMFGFISCR PA
2
674-716 (43) FTGYPSSVQEQALLWLHVLSELDIMVPLQLLISMFSDGVNSVK PA
2
726-736 (11) VSELAGNLASR PA
2
738-746 (9) VSVASDPGR PA
2
748-765 (18) VQHNMLSPFHSPFQSPFR PA
2
778-785 (8) NFGHPGGR PA
2
786-810 (25) TIDFDCEDDEMNLNCFILMFDLLLK PA
2
811-829 (19) QMELQDDGITMGLEHSLSK PA
2
830-851 (22) DIISIINNVFQAPWGGSHTCQK PA
2
855-877 (23) AIECNLCQSSILCYQLACELLER PA
2
886-919 (34) LVEPTDSLEDSLLSSRPEFIIGPEGEEEENPASK PA
2
920-937 (18) HGENPGNCTEPVEHAAVK PA
2
944-954 (11) FCYQQLPVTLR PA
2
955-965 (11) LIYTIFQEMAK PA
2
966-980 (15) FEEPDILFNMLNCLK PA
2
981-993 (13) ILCLHGECLYIAR PA
2
995-1014 (20) DHPQFLAYIQDHMLIASLWR PA
2
1018-1055 (38) SEFSQLSSLAVPLLLHALSLPHGADIFWTIINGNFNSK PA
2
1073-1081 (9) FLDIHSVTK PA
2
1087-1110 (24) YSLAHAFCCFLTAVEDVNPAVATR PA
2
1111-1119 (9) AGLLLDTIK PA
2
1120-1139 (20) RPALQGLCLCLDFQFDTVVK PA
2
1140-1147 (8) DRPTILSK PA
2
1148-1155 (8) LLLLHFLK PA
2
1156-1169 (14) QDIPALSWEFFVNR PA
2
1170-1185 (16) FETLSLEAQLHLDCNK PA
2
1186-1197 (12) EFPFPTTITAVR PA
2
1198-1210 (13) TNVANLSDAALWK PA
2
1240-1250 (11) ALSLPETLTSK PA
2
1258-1285 (28) HEQSAPALGGTPEQTPGQQSPENDNTIK PA
0
1286-1308 (23) DLLPEDAGIDHQTVHQLITVLMK PA
2
1313-1325 (13) DESSAESDISSAK PA
2
1333-1353 (21) HLYVLLGYDQQEGCFMIAPQK PA
2
1356-1379 (24) LSTCFNAFIAGIAQVMDYNINLGK PA
2
1380-1390 (11) HLLPLVVQVLK PA
2
1391-1398 (8) YCSCPQLR PA
2
1399-1406 (8) HYFQQPPR PA
2
1407-1417 (11) CSLWSLKPHIR PA
2
1423-1430 (8) ALLVILYK PA
2
1441-1478 (38) ILLHLIHITVNTLNAQYHSCKPHATAGPLYSDNSNISR PA
2
1485-1493 (9) GEIELAEYR PA
2
1494-1507 (14) ETGALQDSLLHCVR PA
2
1523-1540 (18) SLDIGNADSLLFTLDEHR PA
2
1548-1569 (22) CDIEKPPTQAAYIAQRPNDPGR PA
2
1572-1596 (25) QNSATRPDNSEIPENPAMEGFPDAR PA
2
1597-1604 (8) RPVIPEVR PA
2
1605-1614 (10) LNCMETFEVK PA
2
1615-1624 (10) VDSPVKPAPK PA
2
1625-1642 (18) EDLDLIDLSSDSTSGPEK PA
2
1643-1663 (21) HSILSTSDSDSLVFEPLPPLR PA
2
1664-1684 (21) IVESDEEEETMNQGDDGPSGK PA
2
1685-1716 (32) NAASSPSVPSHPSVLSLSTAPLVQVSVEDCSK PA
2
1722-1766 (45) DSGNNQSAGNTDSALITLEDPMDAEGSSKPEELPEFSCGSPLTLK PA
2
1775-1806 (32) SFALPEMSLDDHPDPGTEGEKPGELMPSSGAK PA
2
1812-1839 (28) VPEDAENPTESEKPDTSAESDTEQNPER PA
2
1841-1852 (12) VEEDGAEESEFK PA
2
1865-1872 (8) IAVSAIQR PA
2
1873-1884 (12) EYLDISFNILDK PA
2
1897-1905 (9) GLSTLEMPR PA
2
1906-1931 (26) ESSSAPTLDAGVPETSSHSSISTQYR PA
2
1936-1948 (13) GSLGVLTMSQLMK PA
2
1950-1973 (24) QLEHQSSAPHNISNWDTEQIQPGK PA
2
1975-1992 (18) QCNVPTCLNPDLEGQPLR PA
2
1999-2029 (31) SSLLSAPSIVSMFVPAPEEFTDEQPTVMTDK PA
2
2030-2076 (47) CHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGR PA
2
2077-2101 (25) LASSTTFSNQAESMMVPGNAAGVAK PA
2
2106-2126 (21) CIFHQLAPNGIFPQLFQSTIK PA
2
2133-2160 (28) TLASSLMDFNELSSIAALSQLLEGLNNK PA
2
2162-2171 (10) NLPAGGAMIR PA
2
2172-2205 (34) CLENIATFMEALPMDSPSSLWTTISNQFQTFFAK PA
2
2206-2213 (8) LPCVLPLK PA
2
2214-2221 (8) CSLDSSLR PA
2
2229-2236 (8) IPSTNATR PA
2
2237-2244 (8) SLLEPFSK PA
2
2245-2269 (25) LLSFVIQNAVFTLAYLVELCGLCYR PA
2
2283-2293 (11) SVVLELLQALK PA
2
2296-2317 (22) SPLPDTNLLLLVQFICADAGTK PA
2
2318-2326 (9) LAESTILSK PA
2
2327-2344 (18) QMIASVPGCGTAAMECVR PA
2
2345-2362 (18) QYINEVLDFMADMHTLTK PA
2
2369-2384 (16) TCSQPLHEDTFGGHLK PA
2
2385-2397 (13) VGLAQIAAMDISR PA
2
2409-2425 (17) YLPWLYHPPSAMQQGPK PA
2
2426-2435 (10) EFIECVSHIR PA
2
2436-2485 (50) LLSWLLLGSLTHNAVCPNASSPCLPIPLDAGSHVADHLIVILIGFPEQSK PA
2
2486-2537 (52) TSVLHMCSLFHAFIFAQLWTVYCEQSAVATNLQNQNEFSFTAILTALEFWSR PA
2
2538-2550 (13) VTPSILQLMAHNK PA
2
2551-2577 (27) VMVEMVCLHVISLMEALQECNSTIFVK PA
2
2578-2591 (14) LIPMWLPMIQSNIK PA
2
2592-2600 (9) HLSAGLQLR PA
2
2601-2614 (14) LQAIQNHVNHHSLR PA
2
2615-2630 (16) TLPGSGQSSAGLAALR PA
2
2632-2639 (8) WLQCTQFK PA
2
2640-2657 (18) MAQVEIQSSEAASQFYPL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center