Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2G3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-28 (21) TSTFDPSHSDNLLHGLNLLWR PA
1
30-48 (19) QLFCDVTLTAQGQQFHCHK PA
1
49-59 (11) AVLASCSQYFR PA
1
60-82 (23) SLFSSHPPLGGGVGGQDGLGAPK PA
1
83-114 (32) DQQQPPQQQPSQQQQPPPQEEPGTPSSSPDDK PA
1
121-136 (16) AINNLVLQGCSSIGLR PA
1
137-162 (26) LVLEYLYTANVTLSLDTVEEVLSVSK PA
1
163-171 (9) ILHIPQVTK PA
1
172-187 (16) LCVQFLNDQISVQNYK PA
1
192-202 (11) IAALHGLEETK PA
1
208-222 (15) YLVEDVLLLNFEEMR PA
1
223-250 (28) ALLDSLPPPVESELALFQMSVLWLEHDR PA
1
254-262 (9) MQYAPDLMK PA
1
266-277 (12) FALIPAPELVER PA
1
278-285 (8) VQSVDFMR PA
1
293-306 (14) LLLDAMNYHLMPFR PA
1
323-336 (14) MLLLVGGLPPGPDR PA
1
337-349 (13) LPSNLVQYYDDEK PA
1
354-388 (35) ILTIMPYNSAHHCVVEVENFLFVLGGEDQWNPNGK PA
0
389-396 (8) HSTNFVSR PA
0
401-413 (13) FNSWIQLPPMQER PA
0
425-432 (8) HLYVIGGR PA
0
433-452 (20) NETGYLSSVECYNLETNEWR PA
0
453-472 (20) YVSSLPQPLAAHAGAVHNGK PA
0
473-500 (28) IYISGGVHNGEYVPWLYCYDPVMDVWAR PA
0
509-519 (11) AIHTLAVMNDR PA
0
520-529 (10) LYAIGGNHLK PA
0
530-545 (16) GFSHLDVMLVECYDPK PA
0
546-560 (15) GDQWNILQTPILEGR PA
0
561-586 (26) SGPGCAVLDDSIYLVGGYSWSMGAYK PA
0
587-596 (10) SSTICYCPEK PA
0
597-628 (32) GTWTELEGDVAEPLAGPACVTVILPSCVPYNK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center