Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2N2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MEVEDSGGVVLTAYHSYAR PA
0
20-28 (9) AQPPNAESR PA
0
33-41 (9) AAASHPLSR PA
0
53-66 (14) MLSNESLHPPAFSR PA
1
67-83 (17) SNSEASVDSASMEDFWR PA
1
90-135 (46) DSSMGGQEEPPPAEVTPVDEGELEAEWLQDVGLSTLISGDEEEDGK PA
1
136-143 (8) ALLSTLTR PA
1
144-151 (8) TQAAAVQK PA
3
153-161 (9) YHTYTQTMR PA
1
173-183 (11) DIFGVSESPPR PA
2
184-197 (14) DTCGNHTNQLDGTK PA
3
208-230 (23) TSGSMPDDASLNSTTLSDASQDK PA
3
231-238 (8) EGSFAVPR PA
3
239-277 (39) SDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEK PA
3
278-301 (24) NIPPEAEELSFEVSYSEMVTEALK PA
3
327-341 (15) FGLTEAGDLSAEDMK PA
3
345-363 (19) HLSLIELTAFFDAFGIQLK PA
3
374-390 (17) DNGIFGVPLTVLLDGDR PA
3
409-421 (13) VEESGLESEGIFR PA
3
465-485 (21) ELPTSLFPVEYIPAFISLMER PA
3
491-508 (18) VQFQALHLMVMALPDANR PA
3
509-520 (12) DAAQALMTFFNK PA
3
530-547 (18) MSLWNISTVMAPNLFFSR PA
3
550-567 (18) HSDYEELLLANTAAHIIR PA
3
579-588 (10) VPSFLITQVR PA
3
590-598 (9) MNEATMLLK PA
3
635-644 (10) MSDVPEGVIR PA
3
645-652 (8) VHAPLLSK PA
3
653-664 (12) VSMAIQLNNQTK PA
3
672-685 (14) FQYENSHGSSECIK PA
1
691-714 (24) LYEIGGNIGEHCLDPDAYILDVYR PA
1
715-729 (15) INPQAEWVIKPQQSS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center