Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2N2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MLSNESLHPPAFSR PA
1
15-31 (17) SNSEASVDSASMEDFWR PA
1
38-83 (46) DSSMGGQEEPPPAEVTPVDEGELEAEWLQDVGLSTLISGDEEEDGK PA
1
84-91 (8) ALLSTLTR PA
1
92-99 (8) TQAAAVQK PA
3
101-109 (9) YHTYTQTMR PA
1
121-131 (11) DIFGVSESPPR PA
2
132-145 (14) DTCGNHTNQLDGTK PA
3
156-178 (23) TSGSMPDDASLNSTTLSDASQDK PA
3
179-186 (8) EGSFAVPR PA
3
187-225 (39) SDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEK PA
3
226-249 (24) NIPPEAEELSFEVSYSEMVTEALK PA
3
275-289 (15) FGLTEAGDLSAEDMK PA
3
293-311 (19) HLSLIELTAFFDAFGIQLK PA
3
322-338 (17) DNGIFGVPLTVLLDGDR PA
3
357-369 (13) VEESGLESEGIFR PA
3
413-433 (21) ELPTSLFPVEYIPAFISLMER PA
3
439-456 (18) VQFQALHLMVMALPDANR PA
3
457-468 (12) DAAQALMTFFNK PA
3
478-495 (18) MSLWNISTVMAPNLFFSR PA
3
498-515 (18) HSDYEELLLANTAAHIIR PA
3
527-536 (10) VPSFLITQVR PA
3
538-546 (9) MNEATMLLK PA
3
583-592 (10) MSDVPEGVIR PA
3
593-600 (8) VHAPLLSK PA
3
601-612 (12) VSMAIQLNNQTK PA
3
632-640 (9) AALSFLNGK PA
1
647-654 (8) EESTETNR PA
1
658-670 (13) HVFLFTIGLDIST PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center