Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9P2N2-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-24 (11) DIFGVSESPPR PA
2
25-38 (14) DTCGNHTNQLDGTK PA
3
49-71 (23) TSGSMPDDASLNSTTLSDASQDK PA
3
72-79 (8) EGSFAVPR PA
3
80-118 (39) SDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEK PA
3
119-142 (24) NIPPEAEELSFEVSYSEMVTEALK PA
3
168-182 (15) FGLTEAGDLSAEDMK PA
3
186-204 (19) HLSLIELTAFFDAFGIQLK PA
3
215-231 (17) DNGIFGVPLTVLLDGDR PA
3
250-262 (13) VEESGLESEGIFR PA
3
306-326 (21) ELPTSLFPVEYIPAFISLMER PA
3
332-349 (18) VQFQALHLMVMALPDANR PA
3
350-361 (12) DAAQALMTFFNK PA
3
371-388 (18) MSLWNISTVMAPNLFFSR PA
3
391-408 (18) HSDYEELLLANTAAHIIR PA
3
420-429 (10) VPSFLITQVR PA
3
431-439 (9) MNEATMLLK PA
3
476-485 (10) MSDVPEGVIR PA
3
486-493 (8) VHAPLLSK PA
3
494-505 (12) VSMAIQLNNQTK PA
3
513-526 (14) FQYENSHGSSECIK PA
1
532-555 (24) LYEIGGNIGEHCLDPDAYILDVYR PA
1
556-570 (15) INPQAEWVIKPQQSS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center