Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9QC07-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-29 (20) VSFLGVTTVEPPKPIPLTWK PA
0
33-43 (11) LVWVNQWPLPK PA
1
46-59 (14) LEALHLLANEQLEK PA
9
60-78 (19) GHIEPSFSPWNSPVFVIQK PA
9
91-114 (24) AVNAVIQPMGPLQPGLPSPAMIPK PA
8
115-124 (10) DWPLIIIDLK PA
9
125-139 (15) DCFFTIPLAEQDCEK PA
9
140-150 (11) FAFTIPAINNK PA
9
160-178 (19) VLPQGMLNSPTICQTFVGR PA
9
187-206 (20) FSDCYIIHYFDDILCAAETK PA
0
209-231 (23) LIDCYTFLQAEVANAGLAIASDK PA
7
232-248 (17) IQTSTPFHYLGMQIENR PA
7
271-297 (27) LLGDINWIRPTLGIPTYAMSNLFSILR PA
6
298-305 (8) GDSDLNSK PA
7
307-314 (8) MLTPEATK PA
3
323-330 (8) IQSAQINR PA
8
331-370 (40) IDPLAPLQLLIFATAHSPTGIIIQNTDLVEWSFLPHSTVK PA
7
371-387 (17) TFTLYLDQIATLIGPTR PA
0
393-400 (8) LCGNDPDK PA
8
412-437 (26) QAFINSGAWQIGLANFVGIIDNHYPK PA
6
446-453 (8) LTTWILPK PA
6
458-475 (18) EPLENALTVFTDGSSNGK PA
8
488-495 (8) TPYQSAQR PA
7
496-526 (31) AELVAVITVLQDFDQPINIISDSAYVVQATR PA
6
527-534 (8) DVETALIK PA
7
535-553 (19) YSMDDQLNQLFNLLQQTVR PA
8
556-565 (10) NFPFYITHIR PA
7
566-576 (11) AHTNLPGPLTK PA
8
577-591 (15) ANEQADLLVSSAFIK PA
0
592-607 (16) AQELHALTHVNAAGLK PA
7
619-651 (33) DIVQHCTQCQVLDLPTQEAGVNPEVCVLMHYGK PA
0
652-662 (11) WMSHMYLHLGR PA
0
663-691 (29) LSYVHVTVDTYSHFMCATCQTGESTSHVK PA
0
693-706 (14) HLLSCFAVMGVPEK PA
8
709-718 (10) TDNGPGYCSK PA
8
729-747 (19) ISHTTGIPYNSQGQAIVER PA
8
767-789 (23) ECTTPQMQLNLALYTLNFLNIYR PA
7
790-802 (13) NQTTTSAEHLTGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center