Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UBS5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGPGAPFAR PA
0
10-41 (32) VGWPLPLLVVMAAGVAPVWASHSPHLPRPHSR PA
0
42-50 (9) VPPHPSSER PA
0
52-85 (34) AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSR PA
4
87-95 (9) DILPDYELK PA
4
103-110 (8) CDPGQATK PA
4
111-122 (12) YLYELLYNDPIK PA
4
123-141 (19) IILMPGCSSVSTLVAEAAR PA
4
142-160 (19) MWNLIVLSYGSSSPALSNR PA
4
169-180 (12) THPSATLHNPTR PA
4
192-212 (21) IATIQQTTEVFTSTLDDLEER PA
4
215-223 (9) EAGIEITFR PA
4
224-235 (12) QSFFSDPAVPVK PA
4
244-255 (12) IIVGLFYETEAR PA
4
271-285 (15) YVWFLIGWYADNWFK PA
4
286-319 (34) IYDPSINCTVDEMTEAVEGHITTEIVMLNPANTR PA
4
320-332 (13) SISNMTSQEFVEK PA
4
340-366 (27) HPEETGGFQEAPLAYDAIWALALALNK PA
4
378-394 (17) LEDFNYNNQTITDQIYR PA
4
395-416 (22) AMNSSSFEGVSGHVVFDASGSR PA
4
417-431 (15) MAWTLIEQLQGGSYK PA
4
433-440 (8) IGYYDSTK PA
4
451-465 (15) WIGGSPPADQTLVIK PA
3
474-503 (30) LFISVSVLSSLGIVLAVVCLSFNIYNSHVR PA
3
504-539 (36) YIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR PA
3
540-549 (10) NQFPFVCQAR PA
3
550-567 (18) LWLLGLGFSLGYGSMFTK PA
3
568-577 (10) IWWVHTVFTK PA
3
593-619 (27) LYATVGLLVGMDVLTLAIWQIVDPLHR PA
3
631-647 (17) EDIDVSILPQLEHCSSR PA
3
649-660 (12) MNTWLGIFYGYK PA
3
661-675 (15) GLLLLLGIFLAYETK PA
3
687-739 (53) AVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPK PA
3
747-758 (12) GEWQSEAQDTMK PA
3
759-770 (12) TGSSTNNNEEEK PA
3
810-823 (14) HPPTPPEPSGGLPR PA
2
824-831 (8) GPPEPPDR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center