Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UBS5-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIR PA
3
53-68 (16) AINFLPVDYEIEYVCR PA
3
81-95 (15) CLANGSWTDMDTPSR PA
3
107-140 (34) AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSR PA
4
142-150 (9) DILPDYELK PA
4
158-165 (8) CDPGQATK PA
4
166-177 (12) YLYELLYNDPIK PA
4
178-196 (19) IILMPGCSSVSTLVAEAAR PA
4
197-215 (19) MWNLIVLSYGSSSPALSNR PA
4
224-235 (12) THPSATLHNPTR PA
4
247-267 (21) IATIQQTTEVFTSTLDDLEER PA
4
270-278 (9) EAGIEITFR PA
4
279-290 (12) QSFFSDPAVPVK PA
4
299-310 (12) IIVGLFYETEAR PA
4
326-340 (15) YVWFLIGWYADNWFK PA
4
341-374 (34) IYDPSINCTVDEMTEAVEGHITTEIVMLNPANTR PA
4
375-387 (13) SISNMTSQEFVEK PA
4
395-421 (27) HPEETGGFQEAPLAYDAIWALALALNK PA
4
433-449 (17) LEDFNYNNQTITDQIYR PA
4
450-471 (22) AMNSSSFEGVSGHVVFDASGSR PA
4
472-486 (15) MAWTLIEQLQGGSYK PA
4
488-495 (8) IGYYDSTK PA
4
506-520 (15) WIGGSPPADQTLVIK PA
3
529-558 (30) LFISVSVLSSLGIVLAVVCLSFNIYNSHVR PA
3
559-594 (36) YIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR PA
3
595-604 (10) NQFPFVCQAR PA
3
605-622 (18) LWLLGLGFSLGYGSMFTK PA
3
623-632 (10) IWWVHTVFTK PA
3
648-674 (27) LYATVGLLVGMDVLTLAIWQIVDPLHR PA
3
686-702 (17) EDIDVSILPQLEHCSSR PA
3
704-715 (12) MNTWLGIFYGYK PA
3
716-730 (15) GLLLLLGIFLAYETK PA
3
742-794 (53) AVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPK PA
3
802-813 (12) GEWQSEAQDTMK PA
3
814-825 (12) TGSSTNNNEEEK PA
3
865-878 (14) HPPTPPEPSGGLPR PA
2
879-886 (8) GPPEPPDR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center