Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UBS5-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIR PA
3
53-68 (16) AINFLPVDYEIEYVCR PA
3
81-95 (15) CLANGSWTDMDTPSR PA
3
103-111 (9) SYLTLENGK PA
2
112-126 (15) VFLTGGDLPALDGAR PA
2
131-142 (12) CDPDFHLVGSSR PA
2
143-161 (19) SICSQGQWSTPKPHCQVNR PA
2
169-202 (34) AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSR PA
4
204-212 (9) DILPDYELK PA
4
220-227 (8) CDPGQATK PA
4
228-239 (12) YLYELLYNDPIK PA
4
240-258 (19) IILMPGCSSVSTLVAEAAR PA
4
259-277 (19) MWNLIVLSYGSSSPALSNR PA
4
286-297 (12) THPSATLHNPTR PA
4
309-329 (21) IATIQQTTEVFTSTLDDLEER PA
4
332-340 (9) EAGIEITFR PA
4
341-352 (12) QSFFSDPAVPVK PA
4
361-372 (12) IIVGLFYETEAR PA
4
388-402 (15) YVWFLIGWYADNWFK PA
4
403-436 (34) IYDPSINCTVDEMTEAVEGHITTEIVMLNPANTR PA
4
437-449 (13) SISNMTSQEFVEK PA
4
457-483 (27) HPEETGGFQEAPLAYDAIWALALALNK PA
4
495-511 (17) LEDFNYNNQTITDQIYR PA
4
512-533 (22) AMNSSSFEGVSGHVVFDASGSR PA
4
534-548 (15) MAWTLIEQLQGGSYK PA
4
550-557 (8) IGYYDSTK PA
4
568-582 (15) WIGGSPPADQTLVIK PA
3
591-620 (30) LFISVSVLSSLGIVLAVVCLSFNIYNSHVR PA
3
621-656 (36) YIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR PA
3
657-666 (10) NQFPFVCQAR PA
3
667-684 (18) LWLLGLGFSLGYGSMFTK PA
3
685-694 (10) IWWVHTVFTK PA
3
710-736 (27) LYATVGLLVGMDVLTLAIWQIVDPLHR PA
3
748-764 (17) EDIDVSILPQLEHCSSR PA
3
766-777 (12) MNTWLGIFYGYK PA
3
778-792 (15) GLLLLLGIFLAYETK PA
3
804-856 (53) AVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPK PA
3
864-875 (12) GEWQSEAQDTMK PA
3
876-887 (12) TGSSTNNNEEEK PA
3
901-910 (10) IIAESGGLPR PA
0
911-918 (8) GPPEPPDR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center