Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIE0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-30 (19) DVAVFFTEEELGLLDPAQR PA
0
32-59 (28) LYQDVMLENFTNLLSVGHQPFHPFHFLR PA
0
63-72 (10) FWMMETATQR PA
1
80-144 (65) TIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGK PA
0
147-166 (20) QSFSDVAIFDPPQQFHSGEK PA
0
167-175 (9) SHTCNECGK PA
0
176-184 (9) SFCYISALR PA
0
204-214 (11) EFSQSSCLQTR PA
0
217-225 (9) VHTGEKPFK PA
27
237-244 (8) AILQVHCK PA
0
245-256 (12) LHTGEKPYICEK PA
0
260-269 (10) AFIHDFQLQK PA
1
270-281 (12) HQIIHTGEKPFK PA
2
298-306 (9) HCMVHTAEK PA
2
316-325 (10) GFTDSLDLHK PA
0
326-339 (14) HQIIHTGQKPYNCK PA
0
347-356 (10) WSSYLLIHQR PA
0
357-365 (9) IHSGEKPYR PA
2
377-384 (8) SGLNLHQR PA
0
385-395 (11) VHTGERPYNCK PA
6
404-411 (8) ASSILNHK PA
3
437-449 (13) DQQGDHNGENSSK PA
0
461-474 (14) LNLDIILSLFLNDM PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center