Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIF8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) LPSSAASSTTPTSSSTPSVASVVSK PA
3
32-53 (22) GGLSTGVASLSSTINPCGHLFR PA
3
54-117 (64) TAGDQPFNLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWR PA
1
125-155 (31) TGATFFPPLLGIPPLFAPPAQNHDSSSFHSR PA
3
168-201 (34) GVNGSINGSNTSSVIGINTSVLSTTASSSMGQTK PA
3
202-210 (9) STSSGGGNR PA
4
238-296 (59) AMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHK PA
4
297-310 (14) SNNQVLLHGISDPK PA
4
325-345 (21) IHQPLPLASESQTHSFQSQQK PA
4
346-364 (19) QPQVLSQQLPFIFQSSQAK PA
4
371-394 (24) HTSVIQSTGLVSNVKPLSLVNQAK PA
4
401-410 (10) LIVPSPDVLK PA
4
415-428 (14) NTSEESSLLTSELR PA
4
436-443 (8) QAFPSQLK PA
4
454-462 (9) VIAALSNPK PA
4
463-472 (10) ATSSSPAHPK PA
4
473-512 (40) QTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTK PA
4
519-542 (24) INENIAAASSTPFSSPVNLSTSGR PA
4
544-564 (21) TPGNQTPVMPSASPILHSQGK PA
4
567-576 (10) AVSNNVNPVK PA
4
577-585 (9) TQHHSHPAK PA
4
593-602 (10) GTDSDIPSSK PA
4
603-654 (52) DSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDK PA
3
655-667 (13) DQDESDSDTEGEK PA
3
681-693 (13) SPSMSLTGHSTPR PA
3
700-735 (36) APGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSK PA
3
747-755 (9) IPLEYGWQR PA
4
766-778 (13) LQGEVAYYAPCGK PA
4
793-800 (8) NGIMDISR PA
2
801-808 (8) DNFSFSAK PA
2
811-818 (8) VGDFYEAR PA
2
819-830 (12) DGPQGMQWCLLK PA
2
846-853 (8) GRPPNPDR PA
4
867-884 (18) GRPPNVGNAEFLDNADAK PA
4
889-896 (8) LQAQEIAR PA
4
922-931 (10) QQAIMAAEEK PA
4
961-968 (8) AQQILEAK PA
4
1061-1079 (19) KPNEDMCLADQKPLPELPR PA
4
1080-1101 (22) IPGLVLSGSTFSDCLMVVQFLR PA
4
1106-1141 (36) VLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVR PA
4
1142-1157 (16) LLSAAVCDPGLITGYK PA
4
1160-1173 (14) TALGEHLLNVGVNR PA
4
1174-1198 (25) DNVSEILQIFMEAHCGQTELTESLK PA
4
1201-1210 (10) AFQAHTPAQK PA
4
1211-1225 (15) ASVLAFLINELACSK PA
4
1226-1233 (8) SVVSEIDK PA
4
1234-1242 (9) NIDYMSNLR PA
4
1267-1288 (22) DTSGGIDLGEEQHPLGTPTPGR PA
4
1294-1321 (28) GGDSDYDDDDDDDSDDQGDEDDEDEEDK PA
4
1329-1349 (21) TDICEDEDEGDQAASVEELEK PA
4
1365-1373 (9) LFDASHSLR PA
4
1374-1381 (8) SVMFGQDR PA
4
1386-1411 (26) YWILPQCGGIFVEGMESGEGLEEIAK PA
4
1426-1447 (22) EEMFETSGDSLNCSNTDHCEQK PA
4
1454-1468 (15) DNTNLFLQKPGSFSK PA
4
1478-1505 (28) MPPESEVMTPKPNAGANGCTLSYQNSGK PA
4
1506-1522 (17) HSLGSVQSTATQSNVEK PA
4
1523-1538 (16) ADSNNLFNTGSSGPGK PA
4
1539-1550 (12) FYSPLPNDQLLK PA
4
1558-1565 (8) QWFSLLPR PA
4
1566-1593 (28) TPCDDTSLTHADMSTASLVTPQSQPPSK PA
4
1594-1623 (30) SPSPTPAPLGSSAQNPVGLNPFALSPLQVK PA
4
1624-1677 (54) GGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSK PA
4
1678-1687 (10) SESPVPQNEK PA
4
1688-1720 (33) ATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWR PA
4
1721-1728 (8) IIDPEDLK PA
4
1751-1761 (11) HLDYITQACLK PA
4
1764-1780 (17) DVAIIELNENEENQVTR PA
4
1781-1808 (28) DIVENWSVEEQAMEMDLSVLQQVEDLER PA
4
1810-1818 (9) VASASLQVK PA
4
1819-1829 (11) GWMCPEPASER PA
4
1830-1838 (9) EDLVYFEHK PA
4
1846-1864 (19) EHDGEFTGEDESSAHALER PA
4
1866-1876 (11) SDNPLDIAVTR PA
4
1888-1897 (10) IEEDIAPGLR PA
4
1908-1921 (14) SAAQVALCIQQLQK PA
4
1940-1954 (15) GDNEELLLLCDGCDK PA
4
1955-1964 (10) GCHTYCHRPK PA
4
1965-1981 (17) ITTIPDGDWFCPACIAK PA
4
2008-2027 (20) VTLTGDTEDEDSASTSSSLK PA
4
2038-2048 (11) MEENTSINLSK PA
4
2049-2056 (8) QESFTSVK PA
4
2065-2092 (28) DLALCSMILTEMETHEDAWPFLLPVNLK PA
4
2103-2111 (9) KPMDFSTIR PA
4
2114-2130 (17) LSSGQYPNLETFALDVR PA
4
2131-2148 (18) LVFDNCETFNEDDSDIGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center