Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIF8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) LPSSAASSTTPTSSSTPSVASVVSK PA
3
32-53 (22) GGLSTGVASLSSTINPCGHLFR PA
3
54-115 (62) TAGDQPFNLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPEWWR PA
1
123-153 (31) TGATFFPPLLGIPPLFAPPAQNHDSSSFHSR PA
3
166-199 (34) GVNGSINGSNTSSVIGINTSVLSTTASSSMGQTK PA
3
200-208 (9) STSSGGGNR PA
4
236-294 (59) AMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHK PA
4
295-308 (14) SNNQVLLHGISDPK PA
4
323-343 (21) IHQPLPLASESQTHSFQSQQK PA
4
344-362 (19) QPQVLSQQLPFIFQSSQAK PA
4
369-392 (24) HTSVIQSTGLVSNVKPLSLVNQAK PA
4
399-408 (10) LIVPSPDVLK PA
4
413-426 (14) NTSEESSLLTSELR PA
4
434-441 (8) QAFPSQLK PA
4
452-460 (9) VIAALSNPK PA
4
461-470 (10) ATSSSPAHPK PA
4
471-510 (40) QTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTK PA
4
517-540 (24) INENIAAASSTPFSSPVNLSTSGR PA
4
542-562 (21) TPGNQTPVMPSASPILHSQGK PA
4
565-574 (10) AVSNNVNPVK PA
4
575-583 (9) TQHHSHPAK PA
4
591-600 (10) GTDSDIPSSK PA
4
601-635 (35) DSEDSNEDEEEDDEEEDEEDDEDDESDDSQSGTSK PA
0
647-655 (9) IPLEYGWQR PA
4
666-678 (13) LQGEVAYYAPCGK PA
4
693-700 (8) NGIMDISR PA
2
701-708 (8) DNFSFSAK PA
2
711-718 (8) VGDFYEAR PA
2
719-730 (12) DGPQGMQWCLLK PA
2
746-753 (8) GRPPNPDR PA
4
767-784 (18) GRPPNVGNAEFLDNADAK PA
4
789-796 (8) LQAQEIAR PA
4
822-831 (10) QQAIMAAEEK PA
4
861-868 (8) AQQILEAK PA
4
961-979 (19) KPNEDMCLADQKPLPELPR PA
4
980-1001 (22) IPGLVLSGSTFSDCLMVVQFLR PA
4
1006-1041 (36) VLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVR PA
4
1042-1057 (16) LLSAAVCDPGLITGYK PA
4
1060-1073 (14) TALGEHLLNVGVNR PA
4
1074-1098 (25) DNVSEILQIFMEAHCGQTELTESLK PA
4
1101-1110 (10) AFQAHTPAQK PA
4
1111-1125 (15) ASVLAFLINELACSK PA
4
1126-1133 (8) SVVSEIDK PA
4
1134-1142 (9) NIDYMSNLR PA
4
1167-1188 (22) DTSGGIDLGEEQHPLGTPTPGR PA
4
1194-1221 (28) GGDSDYDDDDDDDSDDQGDEDDEDEEDK PA
4
1229-1249 (21) TDICEDEDEGDQAASVEELEK PA
4
1265-1273 (9) LFDASHSLR PA
4
1274-1281 (8) SVMFGQDR PA
4
1286-1311 (26) YWILPQCGGIFVEGMESGEGLEEIAK PA
4
1326-1347 (22) EEMFETSGDSLNCSNTDHCEQK PA
4
1354-1368 (15) DNTNLFLQKPGSFSK PA
4
1378-1405 (28) MPPESEVMTPKPNAGANGCTLSYQNSGK PA
4
1406-1422 (17) HSLGSVQSTATQSNVEK PA
4
1423-1438 (16) ADSNNLFNTGSSGPGK PA
4
1439-1450 (12) FYSPLPNDQLLK PA
4
1458-1465 (8) QWFSLLPR PA
4
1466-1493 (28) TPCDDTSLTHADMSTASLVTPQSQPPSK PA
4
1494-1523 (30) SPSPTPAPLGSSAQNPVGLNPFALSPLQVK PA
4
1524-1577 (54) GGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSK PA
4
1578-1587 (10) SESPVPQNEK PA
4
1588-1620 (33) ATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWR PA
4
1621-1628 (8) IIDPEDLK PA
4
1651-1661 (11) HLDYITQACLK PA
4
1664-1680 (17) DVAIIELNENEENQVTR PA
4
1681-1708 (28) DIVENWSVEEQAMEMDLSVLQQVEDLER PA
4
1710-1718 (9) VASASLQVK PA
4
1719-1729 (11) GWMCPEPASER PA
4
1730-1738 (9) EDLVYFEHK PA
4
1746-1764 (19) EHDGEFTGEDESSAHALER PA
4
1766-1776 (11) SDNPLDIAVTR PA
4
1788-1797 (10) IEEDIAPGLR PA
4
1808-1821 (14) SAAQVALCIQQLQK PA
4
1840-1854 (15) GDNEELLLLCDGCDK PA
4
1855-1864 (10) GCHTYCHRPK PA
4
1865-1881 (17) ITTIPDGDWFCPACIAK PA
4
1908-1927 (20) VTLTGDTEDEDSASTSSSLK PA
4
1938-1948 (11) MEENTSINLSK PA
4
1949-1956 (8) QESFTSVK PA
4
1965-1992 (28) DLALCSMILTEMETHEDAWPFLLPVNLK PA
4
2003-2011 (9) KPMDFSTIR PA
4
2014-2030 (17) LSSGQYPNLETFALDVR PA
4
2031-2048 (18) LVFDNCETFNEDDSDIGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center