Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIF8-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) LPSSAASSTTPTSSSTPSVASVVSK PA
3
32-53 (22) GGLSTGVASLSSTINPCGHLFR PA
3
54-117 (64) TAGDQPFNLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPGAEWWR PA
1
125-155 (31) TGATFFPPLLGIPPLFAPPAQNHDSSSFHSR PA
3
168-201 (34) GVNGSINGSNTSSVIGINTSVLSTTASSSMGQTK PA
3
202-210 (9) STSSGGGNR PA
4
238-296 (59) AMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHK PA
4
297-310 (14) SNNQVLLHGISDPK PA
4
325-345 (21) IHQPLPLASESQTHSFQSQQK PA
4
346-364 (19) QPQVLSQQLPFIFQSSQAK PA
4
371-394 (24) HTSVIQSTGLVSNVKPLSLVNQAK PA
4
401-410 (10) LIVPSPDVLK PA
4
415-428 (14) NTSEESSLLTSELR PA
4
436-443 (8) QAFPSQLK PA
4
454-462 (9) VIAALSNPK PA
4
463-472 (10) ATSSSPAHPK PA
4
473-512 (40) QTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTK PA
4
519-542 (24) INENIAAASSTPFSSPVNLSTSGR PA
4
544-564 (21) TPGNQTPVMPSASPILHSQGK PA
4
567-576 (10) AVSNNVNPVK PA
4
577-585 (9) TQHHSHPAK PA
4
593-602 (10) GTDSDIPSSK PA
4
603-654 (52) DSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDK PA
3
655-667 (13) DQDESDSDTEGEK PA
3
681-693 (13) SPSMSLTGHSTPR PA
3
700-735 (36) APGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSK PA
3
747-755 (9) IPLEYGWQR PA
4
766-778 (13) LQGEVAYYAPCGK PA
4
789-796 (8) GMQWCLLK PA
1
812-819 (8) GRPPNPDR PA
4
833-850 (18) GRPPNVGNAEFLDNADAK PA
4
855-862 (8) LQAQEIAR PA
4
888-897 (10) QQAIMAAEEK PA
4
927-934 (8) AQQILEAK PA
4
1027-1045 (19) KPNEDMCLADQKPLPELPR PA
4
1046-1067 (22) IPGLVLSGSTFSDCLMVVQFLR PA
4
1072-1107 (36) VLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVR PA
4
1108-1123 (16) LLSAAVCDPGLITGYK PA
4
1126-1139 (14) TALGEHLLNVGVNR PA
4
1140-1164 (25) DNVSEILQIFMEAHCGQTELTESLK PA
4
1167-1176 (10) AFQAHTPAQK PA
4
1177-1191 (15) ASVLAFLINELACSK PA
4
1192-1199 (8) SVVSEIDK PA
4
1200-1208 (9) NIDYMSNLR PA
4
1233-1254 (22) DTSGGIDLGEEQHPLGTPTPGR PA
4
1260-1287 (28) GGDSDYDDDDDDDSDDQGDEDDEDEEDK PA
4
1295-1315 (21) TDICEDEDEGDQAASVEELEK PA
4
1331-1339 (9) LFDASHSLR PA
4
1340-1347 (8) SVMFGQDR PA
4
1352-1377 (26) YWILPQCGGIFVEGMESGEGLEEIAK PA
4
1392-1413 (22) EEMFETSGDSLNCSNTDHCEQK PA
4
1420-1434 (15) DNTNLFLQKPGSFSK PA
4
1444-1471 (28) MPPESEVMTPKPNAGANGCTLSYQNSGK PA
4
1472-1488 (17) HSLGSVQSTATQSNVEK PA
4
1489-1504 (16) ADSNNLFNTGSSGPGK PA
4
1505-1516 (12) FYSPLPNDQLLK PA
4
1524-1531 (8) QWFSLLPR PA
4
1532-1559 (28) TPCDDTSLTHADMSTASLVTPQSQPPSK PA
4
1560-1589 (30) SPSPTPAPLGSSAQNPVGLNPFALSPLQVK PA
4
1590-1643 (54) GGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSK PA
4
1644-1653 (10) SESPVPQNEK PA
4
1654-1686 (33) ATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWR PA
4
1687-1694 (8) IIDPEDLK PA
4
1717-1727 (11) HLDYITQACLK PA
4
1730-1746 (17) DVAIIELNENEENQVTR PA
4
1747-1774 (28) DIVENWSVEEQAMEMDLSVLQQVEDLER PA
4
1776-1784 (9) VASASLQVK PA
4
1785-1795 (11) GWMCPEPASER PA
4
1796-1804 (9) EDLVYFEHK PA
4
1812-1830 (19) EHDGEFTGEDESSAHALER PA
4
1832-1842 (11) SDNPLDIAVTR PA
4
1854-1863 (10) IEEDIAPGLR PA
4
1874-1887 (14) SAAQVALCIQQLQK PA
4
1906-1920 (15) GDNEELLLLCDGCDK PA
4
1921-1930 (10) GCHTYCHRPK PA
4
1931-1947 (17) ITTIPDGDWFCPACIAK PA
4
1974-1993 (20) VTLTGDTEDEDSASTSSSLK PA
4
2004-2014 (11) MEENTSINLSK PA
4
2015-2022 (8) QESFTSVK PA
4
2031-2058 (28) DLALCSMILTEMETHEDAWPFLLPVNLK PA
4
2069-2077 (9) KPMDFSTIR PA
4
2080-2096 (17) LSSGQYPNLETFALDVR PA
4
2097-2114 (18) LVFDNCETFNEDDSDIGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center