Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIF8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-14 (9) STSSGGGNR PA
4
42-100 (59) AMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHK PA
4
101-114 (14) SNNQVLLHGISDPK PA
4
129-149 (21) IHQPLPLASESQTHSFQSQQK PA
4
150-168 (19) QPQVLSQQLPFIFQSSQAK PA
4
175-198 (24) HTSVIQSTGLVSNVKPLSLVNQAK PA
4
205-214 (10) LIVPSPDVLK PA
4
219-232 (14) NTSEESSLLTSELR PA
4
240-247 (8) QAFPSQLK PA
4
258-266 (9) VIAALSNPK PA
4
267-276 (10) ATSSSPAHPK PA
4
277-316 (40) QTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTK PA
4
323-346 (24) INENIAAASSTPFSSPVNLSTSGR PA
4
348-368 (21) TPGNQTPVMPSASPILHSQGK PA
4
371-380 (10) AVSNNVNPVK PA
4
381-389 (9) TQHHSHPAK PA
4
397-406 (10) GTDSDIPSSK PA
4
407-458 (52) DSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDK PA
3
459-471 (13) DQDESDSDTEGEK PA
3
485-497 (13) SPSMSLTGHSTPR PA
3
504-539 (36) APGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSK PA
3
551-559 (9) IPLEYGWQR PA
4
570-582 (13) LQGEVAYYAPCGK PA
4
597-604 (8) NGIMDISR PA
2
605-612 (8) DNFSFSAK PA
2
615-622 (8) VGDFYEAR PA
2
623-634 (12) DGPQGMQWCLLK PA
2
650-657 (8) GRPPNPDR PA
4
671-688 (18) GRPPNVGNAEFLDNADAK PA
4
693-700 (8) LQAQEIAR PA
4
726-735 (10) QQAIMAAEEK PA
4
765-772 (8) AQQILEAK PA
4
865-883 (19) KPNEDMCLADQKPLPELPR PA
4
884-905 (22) IPGLVLSGSTFSDCLMVVQFLR PA
4
910-945 (36) VLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVR PA
4
946-961 (16) LLSAAVCDPGLITGYK PA
4
964-977 (14) TALGEHLLNVGVNR PA
4
978-1002 (25) DNVSEILQIFMEAHCGQTELTESLK PA
4
1005-1014 (10) AFQAHTPAQK PA
4
1015-1029 (15) ASVLAFLINELACSK PA
4
1030-1037 (8) SVVSEIDK PA
4
1038-1046 (9) NIDYMSNLR PA
4
1071-1092 (22) DTSGGIDLGEEQHPLGTPTPGR PA
4
1098-1125 (28) GGDSDYDDDDDDDSDDQGDEDDEDEEDK PA
4
1133-1153 (21) TDICEDEDEGDQAASVEELEK PA
4
1169-1177 (9) LFDASHSLR PA
4
1178-1185 (8) SVMFGQDR PA
4
1190-1215 (26) YWILPQCGGIFVEGMESGEGLEEIAK PA
4
1230-1251 (22) EEMFETSGDSLNCSNTDHCEQK PA
4
1258-1272 (15) DNTNLFLQKPGSFSK PA
4
1282-1309 (28) MPPESEVMTPKPNAGANGCTLSYQNSGK PA
4
1310-1326 (17) HSLGSVQSTATQSNVEK PA
4
1327-1342 (16) ADSNNLFNTGSSGPGK PA
4
1343-1354 (12) FYSPLPNDQLLK PA
4
1362-1369 (8) QWFSLLPR PA
4
1370-1397 (28) TPCDDTSLTHADMSTASLVTPQSQPPSK PA
4
1398-1427 (30) SPSPTPAPLGSSAQNPVGLNPFALSPLQVK PA
4
1428-1481 (54) GGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSK PA
4
1482-1491 (10) SESPVPQNEK PA
4
1492-1524 (33) ATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWR PA
4
1525-1532 (8) IIDPEDLK PA
4
1555-1565 (11) HLDYITQACLK PA
4
1568-1584 (17) DVAIIELNENEENQVTR PA
4
1585-1612 (28) DIVENWSVEEQAMEMDLSVLQQVEDLER PA
4
1614-1622 (9) VASASLQVK PA
4
1623-1633 (11) GWMCPEPASER PA
4
1634-1642 (9) EDLVYFEHK PA
4
1650-1668 (19) EHDGEFTGEDESSAHALER PA
4
1670-1680 (11) SDNPLDIAVTR PA
4
1692-1701 (10) IEEDIAPGLR PA
4
1712-1725 (14) SAAQVALCIQQLQK PA
4
1744-1758 (15) GDNEELLLLCDGCDK PA
4
1759-1768 (10) GCHTYCHRPK PA
4
1769-1785 (17) ITTIPDGDWFCPACIAK PA
4
1812-1831 (20) VTLTGDTEDEDSASTSSSLK PA
4
1842-1852 (11) MEENTSINLSK PA
4
1853-1860 (8) QESFTSVK PA
4
1869-1896 (28) DLALCSMILTEMETHEDAWPFLLPVNLK PA
4
1907-1915 (9) KPMDFSTIR PA
4
1918-1934 (17) LSSGQYPNLETFALDVR PA
4
1935-1952 (18) LVFDNCETFNEDDSDIGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center