Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIF8-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) LPSSAASSTTPTSSSTPSVASVVSK PA
3
32-53 (22) GGLSTGVASLSSTINPCGHLFR PA
3
54-115 (62) TAGDQPFNLSTVSSAFPMVSHPVFGLHSASSGHSEFGGLGTLGTPTALAAHPQLASFPEWWR PA
1
123-153 (31) TGATFFPPLLGIPPLFAPPAQNHDSSSFHSR PA
3
166-199 (34) GVNGSINGSNTSSVIGINTSVLSTTASSSMGQTK PA
3
200-208 (9) STSSGGGNR PA
4
236-294 (59) AMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHK PA
4
295-308 (14) SNNQVLLHGISDPK PA
4
323-343 (21) IHQPLPLASESQTHSFQSQQK PA
4
344-362 (19) QPQVLSQQLPFIFQSSQAK PA
4
369-392 (24) HTSVIQSTGLVSNVKPLSLVNQAK PA
4
399-408 (10) LIVPSPDVLK PA
4
413-426 (14) NTSEESSLLTSELR PA
4
434-441 (8) QAFPSQLK PA
4
452-460 (9) VIAALSNPK PA
4
461-470 (10) ATSSSPAHPK PA
4
471-510 (40) QTLENNHPNPFLTNALLGNHQPNGVIQSVIQEAPLALTTK PA
4
517-540 (24) INENIAAASSTPFSSPVNLSTSGR PA
4
542-562 (21) TPGNQTPVMPSASPILHSQGK PA
4
565-574 (10) AVSNNVNPVK PA
4
575-583 (9) TQHHSHPAK PA
4
591-600 (10) GTDSDIPSSK PA
4
601-652 (52) DSEDSNEDEEEDDEEEDEEDDEDDESDDSQSESDSNSESDTEGSEEEDDDDK PA
3
653-665 (13) DQDESDSDTEGEK PA
3
679-691 (13) SPSMSLTGHSTPR PA
3
698-733 (36) APGSAPAALCSESQSPAFLGTSSSTLTSSPHSGTSK PA
3
745-753 (9) IPLEYGWQR PA
4
764-776 (13) LQGEVAYYAPCGK PA
4
787-794 (8) GMQWCLLK PA
1
810-817 (8) GRPPNPDR PA
4
831-848 (18) GRPPNVGNAEFLDNADAK PA
4
853-860 (8) LQAQEIAR PA
4
886-895 (10) QQAIMAAEEK PA
4
925-932 (8) AQQILEAK PA
4
1025-1043 (19) KPNEDMCLADQKPLPELPR PA
4
1044-1065 (22) IPGLVLSGSTFSDCLMVVQFLR PA
4
1070-1105 (36) VLGFDVNIDVPNLSVLQEGLLNIGDSMGEVQDLLVR PA
4
1106-1121 (16) LLSAAVCDPGLITGYK PA
4
1124-1137 (14) TALGEHLLNVGVNR PA
4
1138-1162 (25) DNVSEILQIFMEAHCGQTELTESLK PA
4
1165-1174 (10) AFQAHTPAQK PA
4
1175-1189 (15) ASVLAFLINELACSK PA
4
1190-1197 (8) SVVSEIDK PA
4
1198-1206 (9) NIDYMSNLR PA
4
1231-1252 (22) DTSGGIDLGEEQHPLGTPTPGR PA
4
1258-1285 (28) GGDSDYDDDDDDDSDDQGDEDDEDEEDK PA
4
1293-1313 (21) TDICEDEDEGDQAASVEELEK PA
4
1329-1337 (9) LFDASHSLR PA
4
1338-1345 (8) SVMFGQDR PA
4
1350-1375 (26) YWILPQCGGIFVEGMESGEGLEEIAK PA
4
1390-1411 (22) EEMFETSGDSLNCSNTDHCEQK PA
4
1418-1432 (15) DNTNLFLQKPGSFSK PA
4
1442-1469 (28) MPPESEVMTPKPNAGANGCTLSYQNSGK PA
4
1470-1486 (17) HSLGSVQSTATQSNVEK PA
4
1487-1502 (16) ADSNNLFNTGSSGPGK PA
4
1503-1514 (12) FYSPLPNDQLLK PA
4
1522-1529 (8) QWFSLLPR PA
4
1530-1557 (28) TPCDDTSLTHADMSTASLVTPQSQPPSK PA
4
1558-1587 (30) SPSPTPAPLGSSAQNPVGLNPFALSPLQVK PA
4
1588-1641 (54) GGVSMMGLQFCGWPTGVVTSNIPFTSSVPSLGSGLGLSEGNGNSFLTSNVASSK PA
4
1642-1651 (10) SESPVPQNEK PA
4
1652-1684 (33) ATSAQPAAVEVAKPVDFPSPKPIPEEMQFGWWR PA
4
1685-1692 (8) IIDPEDLK PA
4
1715-1725 (11) HLDYITQACLK PA
4
1728-1744 (17) DVAIIELNENEENQVTR PA
4
1745-1772 (28) DIVENWSVEEQAMEMDLSVLQQVEDLER PA
4
1774-1782 (9) VASASLQVK PA
4
1783-1793 (11) GWMCPEPASER PA
4
1794-1802 (9) EDLVYFEHK PA
4
1810-1828 (19) EHDGEFTGEDESSAHALER PA
4
1830-1840 (11) SDNPLDIAVTR PA
4
1852-1861 (10) IEEDIAPGLR PA
4
1872-1885 (14) SAAQVALCIQQLQK PA
4
1904-1918 (15) GDNEELLLLCDGCDK PA
4
1919-1928 (10) GCHTYCHRPK PA
4
1929-1945 (17) ITTIPDGDWFCPACIAK PA
4
1972-1991 (20) VTLTGDTEDEDSASTSSSLK PA
4
2002-2012 (11) MEENTSINLSK PA
4
2013-2020 (8) QESFTSVK PA
4
2029-2056 (28) DLALCSMILTEMETHEDAWPFLLPVNLK PA
4
2067-2075 (9) KPMDFSTIR PA
4
2078-2094 (17) LSSGQYPNLETFALDVR PA
4
2095-2112 (18) LVFDNCETFNEDDSDIGR PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center