Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UIK4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-15 (8) SPNMEPFK PA
1
19-38 (20) VEDFYDIGEELGSGQFAIVK PA
1
44-52 (9) STGLEYAAK PA
1
80-96 (17) QVLHHNVITLHDVYENR PA
1
97-118 (22) TDVVLILELVSGGELFDFLAQK PA
1
119-131 (13) ESLSEEEATSFIK PA
1
132-143 (12) QILDGVNYLHTK PA
1
145-160 (16) IAHFDLKPENIMLLDK PA
3
161-168 (8) NIPIPHIK PA
1
169-185 (17) LIDFGLAHEIEDGVEFK PA
1
186-232 (47) NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTK PA
4
233-259 (27) QETLANITAVSYDFDEEFFSQTSELAK PA
1
274-281 (8) LTIQEALR PA
1
316-331 (16) CHSSMPPNNSYVNFER PA
0
332-341 (10) FACVVEDVAR PA
0
348-370 (23) ALVEAHDTIQDDVEALVSIFNEK PA
0
404-418 (15) EDIQATGCSLGSMAR PA
0
420-431 (12) LDHLQAQFEILR PA
0
432-476 (45) QELSADLQWIQELVGSFQLESGSSEGLGSTFYQDTSESLSELLSR PA
0
477-487 (11) SCTEEFLAGWK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center