Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJ42-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MTALSSENCSFQYQLR PA
0
17-35 (19) QTNQPLDVNYLLFLIILGK PA
0
36-46 (11) ILLNILTLGMR PA
0
49-80 (32) NTCQNFMEYFCISLAFVDLLLLVNISIILYFR PA
0
81-88 (8) DFVLLSIR PA
0
92-126 (35) YHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSK PA
0
137-165 (29) LFYFFTVILIWISVLAYVLGDPAIYQSLK PA
0
173-212 (40) HCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQAIR PA
0
213-235 (23) ITSYMNETILYFPFSSHSSYTVR PA
0
244-266 (23) LIVCFLSTWLPFVLLQVIIVLLK PA
0
267-298 (32) VQIPAYIEMNIPWLYFVNSFLIATVYWFNCHK PA
0
303-315 (13) DIGLPLDPFVNWK PA
0
316-338 (23) CCFIPLTIPNLEQIEKPISIMIC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center