Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJQ7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-52 (40) AEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIR PA
0
57-64 (8) EVGAQLVK PA
0
66-76 (11) VNAVFQLDITK PA
0
90-101 (12) NGSGDMYPGPAR PA
0
102-122 (21) LPADTVFTIPESVFMELVLGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center