Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJV3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGESPASVVLNASGGLFSLK PA
1
21-56 (36) METLESELTCPICLELFEDPLLLPCAHSLCFSCAHR PA
1
57-80 (24) ILVSSCSSGESIEPITAFQCPTCR PA
1
81-88 (8) YVISLNHR PA
1
96-105 (10) NVTLQNIIDR PA
3
109-121 (13) ASVSGPNSPSESR PA
1
125-136 (12) TYRPTTAMSSER PA
1
137-148 (12) IACQFCEQDPPR PA
1
153-164 (12) TCITCEVSYCDR PA
1
181-191 (11) LVEPVPDTHLR PA
1
192-202 (11) GITCLDHENEK PA
1
203-219 (17) VNMYCVSDDQLICALCK PA
1
226-235 (10) DHQVASLNDR PA
1
241-252 (12) QTLEMNLTNLVK PA
1
254-263 (10) NSELENQMAK PA
1
264-281 (18) LIQICQQVEVNTAMHEAK PA
1
282-296 (15) LMEECDELVEIIQQR PA
1
315-323 (9) LAQQVANCR PA
1
329-341 (13) STVLINQAEHILK PA
1
359-388 (30) VAMATASSQVLIPDINFNDAFENFALDFSR PA
1
392-408 (17) LLEGLDYLTAPNPPSIR PA
1
409-450 (42) EELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISK PA
0
451-462 (12) SWCSWGLWPEIR PA
0
479-494 (16) GLYNSVDSWMIVPNIK PA
0
495-508 (14) QNHYTVHGLQSGTR PA
1
515-522 (8) AINQAGSR PA
3
549-558 (10) ISNDGLQMEK PA
1
572-610 (39) FSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYK PA
1
621-629 (9) NASSWVFSR PA
1
630-637 (8) CNSNFVVR PA
1
642-652 (11) EMLVDVPPHLK PA
1
654-696 (43) LGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNK PA
1
697-715 (19) SLMILSGLPAPDFIDYPER PA
1
716-732 (17) QECNCRPQESPYVSGMK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center