Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJX2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MAASTSMVPVAVTAAVAPVLSINSDFSDLR PA
1
35-44 (10) QLLLIAGLTR PA
1
54-91 (38) WSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAK PA
1
102-112 (11) AAHFLHGCNSK PA
1
114-122 (9) AYFLYMYSR PA
1
131-143 (13) DDETVDSLGPLEK PA
1
166-180 (15) ELDGFGLYLYGVVLR PA
1
187-216 (30) EAIDVFVEATHVLPLHWGAWLELCNLITDK PA
1
221-230 (10) FLSLPDTWMK PA
1
231-250 (20) EFFLAHIYTELQLIEEALQK PA
1
251-261 (11) YQNLIDVGFSK PA
1
262-277 (16) SSYIVSQIAVAYHNIR PA
1
282-290 (9) ALSIFNELR PA
1
297-310 (14) IENMDTFSNLLYVR PA
1
314-328 (15) SELSYLAHNLCEIDK PA
1
331-344 (14) VETCCVIGNYYSLR PA
1
364-379 (16) YLGAWTLMGHEYMEMK PA
1
380-389 (10) NTSAAIQAYR PA
1
401-413 (13) AWYGLGQTYEILK PA
1
414-423 (10) MPFYCLYYYR PA
1
425-434 (10) AHQLRPNDSR PA
1
435-445 (11) MLVALGECYEK PA
1
446-453 (8) LNQLVEAK PA
1
459-467 (9) AYAVGDVEK PA
1
476-492 (17) LHEQLTESEQAAQCYIK PA
1
493-514 (22) YIQDIYSCGEIVEHLEESTAFR PA
1
515-522 (8) YLAQYYFK PA
1
525-535 (11) LWDEASTCAQK PA
1
536-543 (8) CCAFNDTR PA
1
558-585 (28) NQGETPTTEVPAPFFLPASLSANNTPTR PA
1
587-597 (11) VSPLNLSSVTP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center