Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJX2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MAASTSMVPVAVTAAVAPVLSINSDFSDLR PA
1
35-44 (10) QLLLIAGLTR PA
1
54-91 (38) WSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAK PA
1
102-112 (11) AAHFLHGCNSK PA
1
114-122 (9) AYFLYMYSR PA
1
131-142 (12) CHSAFSETSIFR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center