Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UJX2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-25 (13) DDETVDSLGPLEK PA
1
48-62 (15) ELDGFGLYLYGVVLR PA
1
69-98 (30) EAIDVFVEATHVLPLHWGAWLELCNLITDK PA
1
103-112 (10) FLSLPDTWMK PA
1
113-132 (20) EFFLAHIYTELQLIEEALQK PA
1
133-143 (11) YQNLIDVGFSK PA
1
144-159 (16) SSYIVSQIAVAYHNIR PA
1
164-172 (9) ALSIFNELR PA
1
179-192 (14) IENMDTFSNLLYVR PA
1
196-210 (15) SELSYLAHNLCEIDK PA
1
213-226 (14) VETCCVIGNYYSLR PA
1
246-261 (16) YLGAWTLMGHEYMEMK PA
1
262-271 (10) NTSAAIQAYR PA
1
283-295 (13) AWYGLGQTYEILK PA
1
296-305 (10) MPFYCLYYYR PA
1
307-316 (10) AHQLRPNDSR PA
1
317-327 (11) MLVALGECYEK PA
1
328-335 (8) LNQLVEAK PA
1
341-349 (9) AYAVGDVEK PA
1
358-374 (17) LHEQLTESEQAAQCYIK PA
1
375-396 (22) YIQDIYSCGEIVEHLEESTAFR PA
1
397-404 (8) YLAQYYFK PA
1
407-417 (11) LWDEASTCAQK PA
1
418-425 (8) CCAFNDTR PA
1
440-467 (28) NQGETPTTEVPAPFFLPASLSANNTPTR PA
1
469-479 (11) VSPLNLSSVTP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center