Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UKG1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-20 (14) LPIEETLEDSPQTR PA
0
21-46 (26) SLLGVFEEDATAISNYMNQLYQAMHR PA
0
47-63 (17) IYDAQNELSAATHLTSK PA
0
73-91 (19) FPLGGDDEVMSSTLQQFSK PA
0
92-119 (28) VIDELSSCHAVLSTQLADAMMFPITQFK PA
0
131-146 (16) EVFQIASNDHDAAINR PA
0
161-171 (11) YEVTEDVYTSR PA
0
174-191 (18) QHQTMMHYFCALNTLQYK PA
0
194-212 (19) IALLEPLLGYMQAQISFFK PA
0
213-237 (25) MGSENLNEQLEEFLANIGTSVQNVR PA
0
239-270 (32) EMDSDIETMQQTIEDLEVASDPLYVPDPDPTK PA
0
290-299 (10) TGLVSSTWDR PA
0
300-314 (15) QFYFTQGGNLMSQAR PA
0
315-338 (24) GDVAGGLAMDIDNCSVMAVDCEDR PA
0
340-350 (11) YCFQITSFDGK PA
0
352-360 (9) SSILQAESK PA
0
362-375 (14) DHEEWICTINNISK PA
0
376-389 (14) QIYLSENPEETAAR PA
0
390-407 (18) VNQSALEAVTPSPSFQQR PA
0
408-424 (17) HESLRPAAGQSRPPTAR PA
0
425-470 (46) TSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAK PA
0
479-490 (12) TNPFGESGGSTK PA
0
491-505 (15) SETEDSILHQLFIVR PA
0
506-513 (8) FLGSMEVK PA
0
514-526 (13) SDDHPDVVYETMR PA
0
540-553 (14) MTESHLLVTCDCLK PA
0
554-563 (10) LIDPQTQVTR PA
0
564-581 (18) LTFPLPCVVLYATHQENK PA
0
595-614 (20) SESNLSSVCYIFESNNEGEK PA
0
615-623 (9) ICDSVGLAK PA
0
624-633 (10) QIALHAELDR PA
0
669-703 (35) LIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center