Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UKS7-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) METEAIDGYITCDNELSPER PA
7
21-51 (31) EHSNMAIDLTSSTPNGQHASPSHMTSTNSVK PA
5
52-62 (11) LEMQSDEECDR PA
5
73-94 (22) GHDEGSSLEEPLIESSEVADNR PA
5
96-106 (11) VQELQGEGGIR PA
5
107-126 (20) LPNGERPFHCNQCGASFTQK PA
2
135-143 (9) LHSGEKPFK PA
16
144-152 (9) CPFCSYACR PA
4
155-162 (8) DALTGHLR PA
20
163-171 (9) THSVGKPHK PA
5
192-219 (28) CHNYLQNVSMEAAGQVMSHHVPPMEDCK PA
1
220-242 (23) EQEPIMDNNISLVPFERPAVIEK PA
2
266-281 (16) FSYPDIHFDMNLTYEK PA
3
282-337 (56) EAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNR PA
3
345-364 (20) ETADSHENNMDGPISLIRPK PA
4
371-403 (33) EASPSNSCLDSTDSESSHDDHQSYQGHPALNPK PA
4
434-443 (10) VFNGEGEQIR PA
4
452-470 (19) VLFLDHVMYTIHMGCHGYR PA
4
471-481 (11) DPLECNICGYR PA
4
486-494 (9) YEFSSHIVR PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center