Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UKS7-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) METEAIDGYITCDNELSPER PA
7
21-51 (31) EHSNMAIDLTSSTPNGQHASPSHMTSTNSVK PA
5
52-62 (11) LEMQSDEECDR PA
5
73-94 (22) GHDEGSSLEEPLIESSEVADNR PA
5
96-106 (11) VQELQGEGGIR PA
5
114-131 (18) CDVCGMVCIGPNVLMVHK PA
4
133-141 (9) SHTGVAVVK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center