Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UKS7-7)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) METEAIDGYITCDNELSPER PA
7
21-51 (31) EHSNMAIDLTSSTPNGQHASPSHMTSTNSVK PA
5
52-62 (11) LEMQSDEECDR PA
5
73-94 (22) GHDEGSSLEEPLIESSEVADNR PA
5
96-106 (11) VQELQGEGGIR PA
5
107-126 (20) LPNGERPFHCNQCGASFTQK PA
2
135-143 (9) LHSGEKPFK PA
16
144-152 (9) CPFCSYACR PA
4
155-162 (8) DALTGHLR PA
20
163-173 (11) THSVPPMEDCK PA
0
174-196 (23) EQEPIMDNNISLVPFERPAVIEK PA
2
220-235 (16) FSYPDIHFDMNLTYEK PA
3
236-291 (56) EAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNR PA
3
299-318 (20) ETADSHENNMDGPISLIRPK PA
4
325-357 (33) EASPSNSCLDSTDSESSHDDHQSYQGHPALNPK PA
4
388-397 (10) VFNGEGEQIR PA
4
406-424 (19) VLFLDHVMYTIHMGCHGYR PA
4
425-435 (11) DPLECNICGYR PA
4
440-448 (9) YEFSSHIVR PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center