Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UKS7-8)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) METEAIDGYITCDNELSPER PA
7
21-67 (47) EHSNMAIDLTSSTPNGQHASPSHMTSTIAEVAPVISSAYSQVYHPNR PA
0
75-94 (20) ETADSHENNMDGPISLIRPK PA
4
101-133 (33) EASPSNSCLDSTDSESSHDDHQSYQGHPALNPK PA
4
164-173 (10) VFNGEGEQIR PA
4
182-200 (19) VLFLDHVMYTIHMGCHGYR PA
4
201-211 (11) DPLECNICGYR PA
4
216-224 (9) YEFSSHIVR PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center