Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UL36-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGLCGLLER PA
1
10-38 (29) CWLHHDPDGVLTLNAENTNYAYQVPNFHK PA
1
39-48 (10) CEICLLSFPK PA
1
68-85 (18) CDQCPQTFNVEFNLTLHK PA
1
86-100 (15) CTHSGEDPTCPVCNK PA
1
110-117 (8) AHIMLHEK PA
1
118-144 (27) EENLICSECGDEFTLQSQLAVHMEEHR PA
1
161-169 (9) EFETSSELK PA
1
193-204 (12) SGFTYSCPHCGK PA
1
205-214 (10) TFQKPSQLTR PA
1
218-226 (9) IHTGERPFK PA
2
238-246 (9) GALQTHMIK PA
1
247-265 (19) HTGEKPHACAFCPAAFSQK PA
1
266-274 (9) GNLQSHVQR PA
1
281-295 (15) NGPTYNCTECSCVFK PA
1
296-306 (11) SLGSLNTHISK PA
1
307-418 (112) MHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQLLELSEPAPVESGQSPQPGQQLSITV
GINQDILQQALENSGLSSIPAAAHPNDSCHAK PA
1
419-446 (28) TSAPHAQNPDVSSVSNEQTDPTDAEQEK PA
1
466-474 (9) SPFLPGSIR PA
1
481-489 (9) WHVCPYCAK PA
1
503-511 (9) IHTHEKPFK PA
1
523-530 (8) STLTAHIK PA
1
546-554 (9) SFSTSGSLK PA
1
559-573 (15) LHTGVRPFACPHCDK PA
1
583-590 (8) THIASHFK PA
1
611-637 (27) TNIPVPDIPLQEPILITDLGLIQPIPK PA
1
638-658 (21) NQFFQSYFNNNFVNEADRPYK PA
1
678-686 (9) SHTGEKPFK PA
1
693-701 (9) GFVSAGVLK PA
1
715-729 (15) CLICNGAFTTGGSLR PA
1
731-748 (18) HMGIHNDLRPYMCPYCQK PA
1
765-859 (95) YELAQQLQQHQQAASIDDSTVDQQSMQASTQMQVEIESDELPQTAEVVAANPEAMLDLEPQHVVGTEEAGLGQQLADQPL
EADEDGFVAPQDPLR PA
1
860-936 (77) GHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPPVQQLQDSSTLESQALSTSFHQQSLLQAPSSDGMNVTTR PA
1
937-964 (28) LIQESSQEELDLQAQGSQFLEDNEDQSR PA
1
988-996 (9) SHTGEKPYK PA
30
1003-1011 (9) GFVSSGVLK PA
1
1022-1040 (19) AFSCSVCNASFTTNGSLTR PA
1
1041-1052 (12) HMATHMSMKPYK PA
1
1053-1061 (9) CPFCEEGFR PA
1
1073-1102 (30) HQTVPSAVSATGETEGGDICMEEEEEHSDR PA
1
1108-1125 (18) SRPEVITFTEEETAQLAK PA
1
1126-1137 (12) IRPQESATVSEK PA
1
1138-1146 (9) VLVQSAAEK PA
1
1156-1164 (9) QAELQDEPK PA
1
1165-1174 (10) HANCCTYCPK PA
1
1188-1196 (9) IHTGEKPYK PA
242
1208-1215 (8) STLDCHVK PA
1
1222-1235 (14) LFSCHVCSNAFSTK PA
1
1244-1252 (9) LHTGAKPFK PA
1
1268-1279 (12) THMQFHYKPDPK PA
1
1288-1532 (245) SSSEGLQPVNLLNSSSTDPNVFIMNNSVLTGQFDQNLLQPGLVGQAILPASVSAGGDLTVSLTDGSLATLEGIQLQLAANLVGPNVQISGIDAASINNITLQIDPSILQQTLQQGNLLAQQLTGEPGLAPQNSSLQTSDSTVPASVVIQPISGLSLQPTVTSANLTIGPLSEQDSVLTTNSSGTQDLTQVMTSQGLVSPSGGPHEITLTINNSSLSQVLAQAAGPTATSSSGSPQEITLTISGSR PA
0
1533-1557 (25) SVQHSVGPQECGSVEALYLENSSDK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center