Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UL45-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-47 (47) MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDK PA
1
48-66 (19) AVEQLAEGLLSHYLPDLQR PA
1
69-77 (9) QALQELTTK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center