Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9ULM0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-16 (11) VEAPASVDWQK PA
0
18-27 (10) CLTLETQLFR PA
0
57-70 (14) AENAETQVGVMEEK PA
0
78-87 (10) NVDSEGSLHR PA
0
100-112 (13) DELISQLEAQLEK PA
0
142-150 (9) LEMENQHLK PA
0
156-176 (21) LVEQVGSLQDALEAIQIAPSR PA
0
178-212 (35) LLVPPYGAAEQDSVPSEPGIQPMGQDSGSQAQGLK PA
0
213-226 (14) AAVLAPSPGALQSK PA
0
227-261 (35) DSVSEAASPLEDSSSSTVHSGETVEAKPLQPHLGR PA
0
262-271 (10) ESPPHQPCMK PA
0
277-291 (15) CSSASWGEGLVTAQR PA
0
303-314 (12) EGGPGSSLTLPK PA
0
331-344 (14) HHSQPQVGHGHFGR PA
0
345-367 (23) VVNIETEAFSALHPSGLPELESR PA
0
377-387 (11) MEMEEPPPAGK PA
0
396-424 (29) ALGAELEEVELGNKPPTPPLHQFSSWESR PA
0
425-434 (10) IYAVATSGMR PA
0
442-466 (25) SNTACCASSPPALVSPGSFSGLVYK PA
0
467-477 (11) NVTVPVYTALK PA
0
480-506 (27) ATQISNMPFMDESSGSDDDCSSQASFR PA
0
507-515 (9) ISVPSSESR PA
1
517-524 (8) TSGLGSPR PA
1
529-560 (32) GVSMSSLSSEGDYAIPPDACSLDSDYSEPEHK PA
1
564-581 (18) TSSYSTDGLGLGGESLEK PA
1
604-611 (8) QGQIMYYK PA
1
619-629 (11) KPQGQVDLNSR PA
1
635-647 (13) GEGSQTFQLISEK PA
1
649-665 (17) TYYLTADSPSLLEEWIR PA
1
673-683 (11) VQATGPPALLR PA
1
684-691 (8) GGTKPTVK PA
1
704-712 (9) VVWCALVGK PA
1
724-732 (9) RPLGCLPVR PA
0
733-741 (9) DAHIEEVDR PA
0
742-755 (14) SCDSDEDYEAGGTR PA
0
757-781 (25) LLSSHCTLVIHPTEHSPTYLLIGTK PA
0
785-801 (17) DTWLYHLTVAAGGSSAK PA
0
802-812 (11) VGTAYEQLIGK PA
0
813-826 (14) LMDGEGDPDSPLWR PA
0
827-834 (8) HPMLCYSK PA
0
835-855 (21) DGLYASLTTLPSEALQTEALK PA
0
859-903 (45) SCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMK PA
0
904-912 (9) QTSCRPPQK PA
0
913-940 (28) YSLMQCWQLLALCAPLFLPQHHFLWYVK PA
0
951-962 (12) SETGQYATYCQR PA
0
980-988 (9) MEVVSILLR PA
0
989-1025 (37) NPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVDEFLQR PA
0
1026-1033 (8) LNQEIGMR PA
0
1034-1050 (17) KPSHSGFALFTDDPSGR PA
0
1051-1061 (11) DLEHCLQGSVK PA
0
1111-1119 (9) LLLASQTSR PA
0
1131-1163 (33) ELALEMAALMAQVEYGDLEKPALPGPGGTSPAK PA
0
1164-1174 (11) AQHLLQQVLDR PA
0
1182-1190 (9) HGAPAEQLR PA
0
1191-1199 (9) HLADMLTTK PA
0
1200-1213 (14) WATLQGCSPPECIR PA
0
1229-1240 (12) LFAAQPAQLSSK PA
0
1241-1280 (40) ENALVWIAVNEDGVSILDHNTMQVHITYPYSSVTTFGGCR PA
0
1281-1288 (8) DDFMLVIR PA
0
1312-1348 (37) IAEATFIMASYMNHCTTTVNPPTNPPGACQLWELDGR PA
0
1349-1359 (11) QFFSSVSCATK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center