Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9ULM0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MPFMDESSGSDDDCSSQASFR PA
0
22-30 (9) ISVPSSESR PA
1
32-39 (8) TSGLGSPR PA
1
44-75 (32) GVSMSSLSSEGDYAIPPDACSLDSDYSEPEHK PA
1
79-96 (18) TSSYSTDGLGLGGESLEK PA
1
119-126 (8) QGQIMYYK PA
1
134-144 (11) KPQGQVDLNSR PA
1
150-162 (13) GEGSQTFQLISEK PA
1
164-180 (17) TYYLTADSPSLLEEWIR PA
1
188-198 (11) VQATGPPALLR PA
1
199-206 (8) GGTKPTVK PA
1
219-227 (9) VVWCALVGK PA
1
239-254 (16) VLLSLLTIPTLLLPPK PA
0
255-269 (15) HMTATLCPDESPYPT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center