Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UPN9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-52 (47) GGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGR PA
1
53-135 (83) AGAEGGAAGPDDGGVAAASSGSAQAASSPAASVGTGVAGGAVSTPAPAPASAPAPGPSAGPPPGPPASLLDTCAVCQQSL
QSR PA
1
142-152 (11) LLPCLHSFCLR PA
1
160-180 (21) QLSVPIPGGSNGDIQQVGVIR PA
1
190-200 (11) QIDLVDNYFVK PA
1
201-212 (12) DTSEAPSSSDEK PA
1
213-239 (27) SEQVCTSCEDNASAVGFCVECGEWLCK PA
1
240-247 (8) TCIEAHQR PA
1
260-280 (21) EDVSESVGASGQRPVFCPVHK PA
1
286-293 (8) LFCETCDR PA
1
298-305 (8) DCQLLEHK PA
3
309-320 (12) YQFLEEAFQNQK PA
1
321-329 (9) GAIENLLAK PA
1
335-347 (13) NYVHFAATQVQNR PA
1
364-375 (12) VAIFTLINEINK PA
1
379-389 (11) SLLQQLENVTK PA
1
395-407 (13) LLQQQNDITGLSR PA
1
411-432 (22) HVMNFTNWAIASGSSTALLYSK PA
1
447-458 (12) CDPVPAANGAIR PA
1
459-468 (10) FHCDPTFWAK PA
1
469-504 (36) NVVNLGNLVIESKPAPGYTPNVVVGQVPPGTNHISK PA
1
505-515 (11) TPGQINLAQLR PA
1
516-527 (12) LQHMQQQVYAQK PA
1
528-535 (8) HQQLQQMR PA
1
536-555 (20) MQQPPAPVPTTTTTTQQHPR PA
1
556-568 (13) QAAPQMLQQQPPR PA
1
569-577 (9) LISVQTMQR PA
1
578-591 (14) GNMNCGAFQAHQMR PA
1
605-619 (15) HSGPQYSMMQPHLQR PA
1
620-655 (36) QHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANR PA
1
656-702 (47) GPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSR PA
1
703-751 (49) YISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR PA
1
752-759 (8) GSCGSSGR PA
1
777-793 (17) QEPGTEDEICSFSGGVK PA
1
803-839 (37) SACMLSSPESSLTPPLSTNLHLESELDALASLENHVK PA
1
840-850 (11) IEPADMNESCK PA
1
851-861 (11) QSGLSSLVNGK PA
1
874-881 (8) IGGDGNNK PA
1
882-904 (23) DDDPNEDWCAVCQNGGDLLCCEK PA
1
908-932 (25) VFHLTCHVPTLLSFPSGDWICTFCR PA
1
933-950 (18) DIGKPEVEYDCDNLQHSK PA
1
954-964 (11) TAQGLSPVDQR PA
1
969-995 (27) LLLYLYCHELSIEFQEPVPASIPNYYK PA
1
999-1007 (9) KPMDLSTVK PA
1
1014-1029 (16) HSQHYQIPDDFVADVR PA
1
1044-1057 (14) VVQVYADTQEINLK PA
0
1058-1067 (10) ADSEVAQAGK PA
0
1068-1076 (9) AVALYFEDK PA
1
1077-1084 (8) LTEIYSDR PA
1
1085-1113 (29) TFAPLPEFEQEEDDGEVTEDSDEDFIQPR PA
1
1119-1127 (9) SDERPVHIK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center