Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UPV0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-34 (27) IGDQLVLEEDYDETYIPSEQEILEFAR PA
1
35-42 (8) EIGIDPIK PA
1
43-51 (9) EPELMWLAR PA
1
52-93 (42) EGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYR PA
1
103-110 (8) LSTSGAIK PA
1
129-151 (23) SSLALGSSLAPVHVPLGGLAPLR PA
1
152-162 (11) GLVDTPPSALR PA
1
163-177 (15) GSQSVSLGSSVESGR PA
1
178-190 (13) QLGELMLPSQGLK PA
1
197-206 (10) GLLGSIYEDK PA
1
207-239 (33) TALSLLGLGEETNEEDEEESDNQSVHSSSEPLR PA
1
240-259 (20) NLHLDIGALGGDFEYEESLR PA
1
268-299 (32) DVSLDSDAAGPPTPCKPSSPGADSSLSSAVGK PA
1
302-313 (12) QGSGARPGLPEK PA
1
332-341 (10) ADPTGSEPAK PA
1
346-360 (15) EAPEDTVDAGEEGSR PA
1
372-393 (22) ASALEEGSSDASQELEISEHMK PA
1
394-406 (13) EPQLSDSIASDPK PA
1
407-416 (10) SFHGLDFGFR PA
1
419-438 (20) ISEHLLDVDVLSPVLGGACR PA
1
439-449 (11) QAQQPLGIEDK PA
1
450-462 (13) DDSQSSQDELQSK PA
1
471-480 (10) LSPPLPHEER PA
1
487-505 (19) SLATEEEPPQGPEGQPEWK PA
1
506-526 (21) EAEELGEDSAASLSLQLSLQR PA
1
527-538 (12) EQAPSPPAACEK PA
1
541-562 (22) EQHSQAEELGPGQEEAEDPEEK PA
1
563-576 (14) VAVSPTPPVSPEVR PA
1
577-593 (17) STEPVAPPEQLSEAALK PA
1
594-608 (15) AMEEAVAQVLEQDQR PA
1
625-635 (11) LCQEEEEEILR PA
1
641-648 (8) EQSLSSLR PA
1
654-661 (8) AIEEEEAR PA
1
675-689 (15) AQVQSSTQADEDQIR PA
1
690-698 (9) AEQEASLQK PA
1
701-708 (8) EELESQQK PA
1
727-734 (8) EEIEASEK PA
1
735-744 (10) SEQAALNAAK PA
1
761-768 (8) EAVATLEK PA
1
769-776 (8) EHSAELER PA
1
777-784 (8) LCSSLEAK PA
1
787-794 (8) EVVSSLQK PA
1
810-817 (8) CLGQVEHR PA
1
822-837 (16) SYHVAGYEHELSSLLR PA
1
841-849 (9) QEVEGEHER PA
1
856-864 (9) EEHQQVMAK PA
1
867-874 (8) EQYEAEER PA
1
878-890 (13) AELLGHLTGELER PA
1
924-934 (11) LQDLELDLETR PA
1
942-953 (12) LALLEVQEETAR PA
1
957-964 (8) QQLLDVQR PA
1
970-985 (16) SEEATATHQQLEEAQK PA
1
986-998 (13) EHTHLLQSNQQLR PA
1
999-1007 (9) EILDELQAR PA
1
1011-1027 (17) LESQVDLLQAQSQQLQK PA
1
1028-1038 (11) HFSSLEAEAQK PA
1
1045-1067 (23) EVTVEENNASPHFEPDLHIEDLR PA
1
1069-1076 (8) SLGTNQTK PA
1
1077-1086 (10) EVSSSLSQSK PA
1
1087-1111 (25) EDLYLDSLSSHNVWHLLSAEGVALR PA
1
1115-1122 (8) EFLVQQTR PA
1
1140-1150 (11) HELASAQEVAK PA
1
1193-1216 (24) LNQLESSLWEEASDEGTLGGSPTK PA
1
1218-1242 (25) AVTFDLSDMDSLSSESSESFSPPHR PA
0
1250-1259 (10) IDSTPSLTSR PA
0
1261-1269 (9) IHGLSHSLR PA
1
1270-1304 (35) QISSQLSSVLSILDSLNPQSPPPLLASMPAQLPPR PA
1
1308-1320 (13) STPTPTYYGSLAR PA
1
1321-1343 (23) FSALSSATPTSTQWAWDSGQGPR PA
1
1344-1359 (16) LPSSVAQTVDDFLLEK PA
1
1363-1381 (19) YFPSGIPLLSNSPTPLESR PA
1
1382-1392 (11) LGYMSASEQLR PA
1
1393-1417 (25) LLQHSHSQVPEAGSTTFQGIIEANR PA
1
1429-1439 (11) LPLFSSTPKPK PA
1
1440-1454 (15) ATLSLLQLGLDEHNR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center