Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UPV0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-34 (27) IGDQLVLEEDYDETYIPSEQEILEFAR PA
1
35-42 (8) EIGIDPIK PA
1
43-51 (9) EPELMWLAR PA
1
52-93 (42) EGIVAPLPGEWKPCQDITGDIYYFNFANGQSMWDHPCDEHYR PA
1
103-110 (8) LSTSGAIK PA
1
129-151 (23) SSLALGSSLAPVHVPLGGLAPLR PA
1
152-162 (11) GLVDTPPSALR PA
1
163-177 (15) GSQSVSLGSSVESGR PA
1
178-190 (13) QLGELMLPSQGLK PA
1
197-206 (10) GLLGSIYEDK PA
1
207-239 (33) TALSLLGLGEETNEEDEEESDNQSVHSSSEPLR PA
1
240-259 (20) NLHLDIGALGGDFEYEESLR PA
1
268-299 (32) DVSLDSDAAGPPTPCKPSSPGADSSLSSAVGK PA
1
302-313 (12) QGSGARPGLPEK PA
1
332-341 (10) ADPTGSEPAK PA
1
346-360 (15) EAPEDTVDAGEEGSR PA
1
372-393 (22) ASALEEGSSDASQELEISEHMK PA
1
394-406 (13) EPQLSDSIASDPK PA
1
407-416 (10) SFHGLDFGFR PA
1
419-438 (20) ISEHLLDVDVLSPVLGGACR PA
1
439-449 (11) QAQQPLGIEDK PA
1
450-462 (13) DDSQSSQDELQSK PA
1
474-483 (10) LSPPLPHEER PA
1
490-508 (19) SLATEEEPPQGPEGQPEWK PA
1
509-529 (21) EAEELGEDSAASLSLQLSLQR PA
1
530-541 (12) EQAPSPPAACEK PA
1
544-565 (22) EQHSQAEELGPGQEEAEDPEEK PA
1
566-579 (14) VAVSPTPPVSPEVR PA
1
580-596 (17) STEPVAPPEQLSEAALK PA
1
597-611 (15) AMEEAVAQVLEQDQR PA
1
628-638 (11) LCQEEEEEILR PA
1
644-651 (8) EQSLSSLR PA
1
657-664 (8) AIEEEEAR PA
1
678-692 (15) AQVQSSTQADEDQIR PA
1
693-701 (9) AEQEASLQK PA
1
704-711 (8) EELESQQK PA
1
730-737 (8) EEIEASEK PA
1
738-747 (10) SEQAALNAAK PA
1
764-771 (8) EAVATLEK PA
1
772-779 (8) EHSAELER PA
1
780-787 (8) LCSSLEAK PA
1
790-797 (8) EVVSSLQK PA
1
813-820 (8) CLGQVEHR PA
1
825-840 (16) SYHVAGYEHELSSLLR PA
1
844-852 (9) QEVEGEHER PA
1
859-867 (9) EEHQQVMAK PA
1
870-877 (8) EQYEAEER PA
1
881-893 (13) AELLGHLTGELER PA
1
927-937 (11) LQDLELDLETR PA
1
945-956 (12) LALLEVQEETAR PA
1
960-967 (8) QQLLDVQR PA
1
973-988 (16) SEEATATHQQLEEAQK PA
1
989-1001 (13) EHTHLLQSNQQLR PA
1
1002-1010 (9) EILDELQAR PA
1
1014-1030 (17) LESQVDLLQAQSQQLQK PA
1
1031-1041 (11) HFSSLEAEAQK PA
1
1048-1070 (23) EVTVEENNASPHFEPDLHIEDLR PA
1
1072-1079 (8) SLGTNQTK PA
1
1080-1089 (10) EVSSSLSQSK PA
1
1090-1114 (25) EDLYLDSLSSHNVWHLLSAEGVALR PA
1
1118-1125 (8) EFLVQQTR PA
1
1143-1153 (11) HELASAQEVAK PA
1
1196-1219 (24) LNQLESSLWEEASDEGTLGGSPTK PA
1
1221-1254 (34) AVTFDLSDMDSLSSESSESFSPPHLDSTPSLTSR PA
0
1256-1264 (9) IHGLSHSLR PA
1
1265-1299 (35) QISSQLSSVLSILDSLNPQSPPPLLASMPAQLPPR PA
1
1303-1315 (13) STPTPTYYGSLAR PA
1
1316-1338 (23) FSALSSATPTSTQWAWDSGQGPR PA
1
1339-1354 (16) LPSSVAQTVDDFLLEK PA
1
1358-1376 (19) YFPSGIPLLSNSPTPLESR PA
1
1377-1387 (11) LGYMSASEQLR PA
1
1388-1412 (25) LLQHSHSQVPEAGSTTFQGIIEANR PA
1
1424-1434 (11) LPLFSSTPKPK PA
1
1435-1449 (15) ATLSLLQLGLDEHNR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center