Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UQ07-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-20 (11) IGEGTFSEVMK PA
3
26-33 (8) DGNYYACK PA
3
39-49 (11) FESIEQVNNLR PA
2
57-73 (17) LNPHPNILMLHEVVFDR PA
2
75-94 (20) SGSLALICELMDMNIYELIR PA
3
105-114 (10) IMHYMYQLCK PA
3
128-137 (10) DVKPENILIK PA
3
143-150 (8) LGDFGSCR PA
3
156-165 (10) QPYTEYISTR PA
3
169-182 (14) APECLLTDGFYTYK PA
3
183-213 (31) MDLWSAGCVFYEIASLQPLFPGVNELDQISK PA
3
214-224 (11) IHDVIGTPAQK PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center