Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UQ07-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-20 (11) IGEGTFSEVMK PA
3
26-33 (8) DGNYYACK PA
3
45-64 (20) SGSLALICELMDMNIYELIR PA
3
75-84 (10) IMHYMYQLCK PA
3
98-107 (10) DVKPENILIK PA
3
113-120 (8) LGDFGSCR PA
3
126-135 (10) QPYTEYISTR PA
3
139-152 (14) APECLLTDGFYTYK PA
3
153-183 (31) MDLWSAGCVFYEIASLQPLFPGVNELDQISK PA
3
184-194 (11) IHDVIGTPAQK PA
3
204-212 (9) AMNFDFPFK PA
2
214-243 (30) GSGIPLLTTNLSPQCLSLLHAMVAYDPDER PA
3
244-259 (16) IAAHQALQHPYFQEQR PA
3
272-292 (21) AGFPEHPVAPEPLSNSCQISK PA
2
312-321 (10) GPAYVMELPK PA
2
330-349 (20) LSSYSSPTLQSVLGSGTNGR PA
3
350-357 (8) VPVLRPLK PA
3
370-379 (10) DLKPAPQQCR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center