Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9UQ07-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-20 (11) IGEGTFSEVMK PA
3
26-33 (8) DGNYYACK PA
3
39-49 (11) FESIEQVNNLR PA
2
57-73 (17) LNPHPNILMLHEVVFDR PA
2
75-94 (20) SGSLALICELMDMNIYELIR PA
3
105-114 (10) IMHYMYQLCK PA
3
128-137 (10) DVKPENILIK PA
3
142-149 (8) LGDFGSCR PA
3
155-164 (10) QPYTEYISTR PA
3
168-181 (14) APECLLTDGFYTYK PA
3
182-212 (31) MDLWSAGCVFYEIASLQPLFPGVNELDQISK PA
3
213-223 (11) IHDVIGTPAQK PA
3
233-241 (9) AMNFDFPFK PA
2
243-272 (30) GSGIPLLTTNLSPQCLSLLHAMVAYDPDER PA
3
273-288 (16) IAAHQALQHPYFQEQR PA
3
301-321 (21) AGFPEHPVAPEPLSNSCQISK PA
2
341-350 (10) GPAYVMELPK PA
2
359-378 (20) LSSYSSPTLQSVLGSGTNGR PA
3
379-386 (8) VPVLRPLK PA
3
399-408 (10) DLKPAPQQCR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center