Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y267-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MAGEENFK PA
0
19-39 (21) NLNQHEVAGHPHSWSLEMLLR PA
0
52-68 (17) FANLLDAVGEFGTFQQR PA
0
69-112 (44) LVALTFIPSIMSAFFMFADHFVFTAQKPYCNTSWILAVGPHLSK PA
0
113-165 (53) AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAK PA
0
168-182 (15) SLINEFDLVCGMETK PA
0
184-202 (19) DTAQIMFMAGLPIGSLIFR PA
0
211-241 (31) YPAILLSLLGLIIFGFGTAFMNSFHLYLFFR PA
0
242-268 (27) FGISQSVVGYAISSISLATEWLVGEHR PA
0
269-322 (54) AHAIILGHCFFAVGAVLLTGIAYSLPHWQLLFLVGGILVIPFISYIWILPESPR PA
0
335-345 (11) QVLCYAASVNK PA
0
347-360 (14) TIPSNLLDELQLPR PA
0
366-373 (8) ASVLDFCK PA
0
380-401 (22) VTLVMSCVWFTVSYTYFTLSLR PA
0
404-412 (9) ELGVSVHFR PA
0
413-424 (12) HVVPSIMEVPAR PA
0
425-436 (12) LCCIFLLQQIGR PA
0
438-465 (28) WSLAVTLLQAIIWCLLLLFLPEGEDGLR PA
0
478-487 (10) SMTILVLMLR PA
0
488-511 (24) EFSLAATVTVFFLYTAELLPTVLR PA
0
512-563 (52) ATGLGLVSLASVAGAILSLTIISQTPSLLPIFLCCVLAIVAFSLSSLLPETR PA
0
564-578 (15) DQPLSESLNHSSQIR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center