Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2I6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MDEEENHYVSQLR PA
1
14-29 (16) EVYSSCDTTGTGFLDR PA
1
30-38 (9) QELTQLCLK PA
1
39-60 (22) LHLEQQLPVLLQTLLGNDHFAR PA
1
68-101 (34) EGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPK PA
1
113-125 (13) SRPELCDAATEAR PA
1
127-137 (11) VPEQQTQASLK PA
1
143-153 (11) SASLESVESPK PA
1
154-162 (9) SDEEAESTK PA
1
163-188 (26) EAQNELFEAQGQLQTWDSEDFGSPQK PA
1
189-202 (14) SCSPSFDTPESQIR PA
1
203-235 (33) GVWEELGVGSSGHLSEQELAVVCQSVGLQGLEK PA
1
236-244 (9) EELEDLFNK PA
1
245-252 (8) LDQDGDGK PA
1
253-276 (24) VSLEEFQLGLFSHEPALLLESSTR PA
1
282-310 (29) AWSHYQVPEESGCHTTTTSSLVSLCSSLR PA
1
311-340 (30) LFSSIDDGSGFAFPDQVLAMWTQEGIQNGR PA
1
341-353 (13) EILQSLDFSVDEK PA
1
354-398 (45) VNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLAR PA
1
420-434 (15) EMDDCHSTLEQLTEK PA
1
459-467 (9) ELFWEQAHR PA
1
470-478 (9) AALEWDVGR PA
1
479-487 (9) LQAEEAGLR PA
1
503-510 (8) EIVEVVEK PA
1
533-546 (14) LEPQSAELLAQEER PA
1
565-578 (14) NDELQAELEGLWAR PA
1
584-593 (10) HSPSWSPDGR PA
1
596-626 (31) QLPGLGPAGISFLGNSAPVSIETELMMEQVK PA
1
668-676 (9) EVSVLEGQK PA
1
677-685 (9) ADLEELHEK PA
1
686-702 (17) SQEVIWGLQEQLQDTAR PA
1
703-725 (23) GPEPEQMGLAPCCTQALCGLALR PA
1
726-734 (9) HHSHLQQIR PA
1
736-754 (19) EAEAELSGELSGLGALPAR PA
0
756-771 (16) DLTLELEEPPQGPLPR PA
0
776-783 (8) SEQLELER PA
0
787-794 (8) LQPCASEK PA
0
796-813 (18) AQMCVSLALEEEELELAR PA
0
817-831 (15) VDGPSLEAEMQALPK PA
0
832-844 (13) DGLVAGSGQEGTR PA
0
845-867 (23) GLLPLRPGCGERPLAWLAPGDGR PA
0
868-878 (11) ESEEAAGAGPR PA
0
881-905 (25) QAQDTEATQSPAPAPAPASHGPSER PA
0
909-921 (13) MQPCGVDGDIVPK PA
0
922-939 (18) EPEPFGASAAGLEQPGAR PA
0
940-948 (9) ELPLLGTER PA
0
949-956 (8) DASQTQPR PA
0
957-969 (13) MWEPPLRPAASCR PA
0
975-982 (8) LQAIQEER PA
0
989-1000 (12) GTQEQASEQQAR PA
0
1001-1011 (11) AEGALEPGCHK PA
0
1020-1048 (29) GSLPSHLQLADPQGSWQEQLAAPEEGETK PA
0
1062-1070 (9) LLHLEDVVR PA
0
1089-1097 (9) LSEENTLLK PA
1
1105-1118 (14) QELEAAESTHDAQR PA
1
1131-1140 (10) ACSEMEVLNR PA
1
1147-1155 (9) DQLSQLNVR PA
1
1156-1174 (19) VLQLGQEASTHQAQNEEHR PA
1
1175-1189 (15) VTIQMLTQSLEEVVR PA
1
1190-1200 (11) SGQQQSDQIQK PA
1
1203-1239 (37) VELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLR PA
1
1242-1252 (11) QAQAQHLQEVR PA
1
1265-1274 (10) LLSLQGEQAR PA
1
1295-1303 (9) VEEAEMILK PA
1
1304-1312 (9) NMEMLLQEK PA
1
1332-1342 (11) ELYVENAHLVR PA
1
1343-1350 (8) ALQATEEK PA
1
1375-1382 (8) IAPAALSV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center