Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2I6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MDEEENHYVSQLR PA
1
14-29 (16) EVYSSCDTTGTGFLDR PA
1
30-38 (9) QELTQLCLK PA
1
39-60 (22) LHLEQQLPVLLQTLLGNDHFAR PA
1
68-101 (34) EGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPK PA
1
113-125 (13) SRPELCDAATEAR PA
1
127-137 (11) VPEQQTQASLK PA
1
143-153 (11) SASLESVESPK PA
1
154-162 (9) SDEEAESTK PA
1
163-188 (26) EAQNELFEAQGQLQTWDSEDFGSPQK PA
1
189-202 (14) SCSPSFDTPESQIR PA
1
203-235 (33) GVWEELGVGSSGHLSEQELAVVCQSVGLQGLEK PA
1
236-244 (9) EELEDLFNK PA
1
245-252 (8) LDQDGDGK PA
1
253-276 (24) VSLEEFQLGLFSHEPALLLESSTR PA
1
282-310 (29) AWSHYQVPEESGCHTTTTSSLVSLCSSLR PA
1
311-340 (30) LFSSIDDGSGFAFPDQVLAMWTQEGIQNGR PA
1
341-353 (13) EILQSLDFSVDEK PA
1
354-398 (45) VNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLAR PA
1
420-434 (15) EMDDCHSTLEQLTEK PA
1
459-467 (9) ELFWEQAHR PA
1
470-478 (9) AALEWDVGR PA
1
479-487 (9) LQAEEAGLR PA
1
503-510 (8) EIVEVVEK PA
1
533-546 (14) LEPQSAELLAQEER PA
1
565-578 (14) NDELQAELEGLWAR PA
1
584-593 (10) HSPSWSPDGR PA
1
596-626 (31) QLPGLGPAGISFLGNSAPVSIETELMMEQVK PA
1
668-676 (9) EVSVLEGQK PA
1
677-685 (9) ADLEELHEK PA
1
686-702 (17) SQEVIWGLQEQLQDTAR PA
1
703-725 (23) GPEPEQMGLAPCCTQALCGLALR PA
1
726-734 (9) HHSHLQQIR PA
1
740-748 (9) LSEENTLLK PA
1
756-769 (14) QELEAAESTHDAQR PA
1
782-791 (10) ACSEMEVLNR PA
1
798-806 (9) DQLSQLNVR PA
1
807-825 (19) VLQLGQEASTHQAQNEEHR PA
1
826-840 (15) VTIQMLTQSLEEVVR PA
1
841-851 (11) SGQQQSDQIQK PA
1
854-890 (37) VELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLR PA
1
893-903 (11) QAQAQHLQEVR PA
1
916-925 (10) LLSLQGEQAR PA
1
946-954 (9) VEEAEMILK PA
1
955-963 (9) NMEMLLQEK PA
1
983-993 (11) ELYVENAHLVR PA
1
994-1001 (8) ALQATEEK PA
1
1026-1033 (8) IAPAALSV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center